KEGG   Nasonia vitripennis (jewel wasp): 100118414
Entry
100118414         CDS       T01081                                 
Name
(RefSeq) piwi-like protein Siwi isoform X1
  KO
K02156  aubergine
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
nvi04320  Dorso-ventral axis formation
Brite
KEGG Orthology (KO) [BR:nvi00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04320 Dorso-ventral axis formation
    100118414
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:nvi03036]
    100118414
Chromosome and associated proteins [BR:nvi03036]
 Eukaryotic type
  Gene silencing
   RISC (RNA-induced silencing complex)
    100118414
   piRNA pathway
    100118414
SSDB
Motif
Pfam: Piwi PAZ ArgoN ArgoMid ArgoL1 CttA_N
Other DBs
NCBI-GeneID: 100118414
NCBI-ProteinID: XP_001602384
NASONIABASE: NV12150
UniProt: A0A7M7G3W4
Position
5
AA seq 893 aa
MPKYPGDKRRYYDDMGDRGRAMSRGHRGTRRNRDDQEQPSTSQERSRSSSQHGEPYPRRP
GPPTQKLPEGYPSSARGETIRAVEHRPQPTYSETASDTASVAGSVDGGSAAPSSSLGRGA
MRGRRVLPANIITRPTTLETKQGITGRPIELIANYFKLLSTTDWCLHKYRVDFSPEEDRK
VVCKGLLRPHRETLGAYIFDGSTLYTSTRLPETLELTSERLGDKQCMLIKIKHTGEMTRG
DHDYIQFFNIIMRKCLDYLELQLVGRNYFDAKNKVEVRDFKLELWPGYITSIRQHEEDIL
MCAEITHKVMRNETLLDVLIQCHEENRQDYKNFFKKQVIGVVVLTDYNNNTYRIDDVDFE
VTPSSTFRKKTGEEISYVQYYRSRYNLNIREMRQPLLVSKSKPRDRRAGKEELVYLVPEL
CRSTGLTDLMRNNFRLMSALAQYTRVSPGDRIKKLMSFNMRLHNVPNVVSELSSWNLQLD
RRLVTLTGRVLPADNIVYYQNDQVPVNNKANWTNDFRNKKLLKCGVLDNWVVIVPDRLKR
DCQNFVGQMIRVASTMGFRIEQPYVREIRNDQAASYADILENIKSTSNPMLIFCVATNNR
MDRYAAIKKKCCVDRPVPTQVVLAKSLQNKNAMSIATKIVIQMNCKIGGIPWSIPIPLKG
LMVVGFDVCHDTNSKDKDFGAMVASLDPHFGRYFSAVSSHTSGEELSNDLSVNLCKALAQ
FKHYNNALPKRIVIYRDGVGEGQVPMVFSHEVQQIKNKLETVYDNADDVKLAYVIVTKKI
NSRLFAGNQNPPPGTVIDDVITDPTRYDFMIISQHVTQGTVTPTAYNIIYDTCGMDADKL
QRLTYKLCHMYFNWSGTVRVPAPCQYAHKLAFLVAQAVHQSPDVMLETLLYFL
NT seq 2682 nt   +upstreamnt  +downstreamnt
atgccgaagtatccaggcgacaaacgtcgttattacgacgatatgggtgaccgaggacga
gccatgagccgcgggcaccgcggcactaggagaaatcgtgatgaccaggagcagccaagt
acctcgcaagagaggtcgcgctcaagttctcagcatggagaaccttaccctcgccgaccc
ggacctccgactcaaaaactacccgaaggctatccgagttcagcacgtggggagaccatt
agagcagttgagcacagacctcagccaacgtattcagaaactgcttcagacactgcttca
gttgcaggatcagttgacggtggatcagcagccccatcttcatcgttgggaagaggagcc
atgcgtggcaggcgagttttacctgccaatattatcactagaccaaccacgcttgaaacc
aagcaaggaataactggacggccgatagaattaatagcaaattacttcaaactcttaagt
acaactgactggtgcttgcacaagtacagagttgacttctctccagaggaagacagaaaa
gtcgtatgcaaaggtctccttagaccccatagagaaactcttggtgcttacatttttgat
ggctcgactttgtacaccagcacaagattaccagaaaccctagaattaacatctgaacga
ttaggagacaagcaatgtatgctcattaaaataaaacacactggagaaatgaccagaggg
gatcatgactatatccaattcttcaacataataatgagaaaatgtcttgactatcttgag
cttcaactagttggccgtaactattttgatgcaaaaaataaggttgaagtaagagatttt
aagcttgaactttggccaggatatatcacttctattcgccaacatgaagaagacatttta
atgtgtgctgaaataacacacaaagttatgcgcaacgaaacgttactcgatgtgttaatc
caatgccatgaagaaaacagacaagattacaaaaacttcttcaagaagcaagtcattgga
gttgtagtgcttacagactacaataacaacacttacagaatcgatgatgttgactttgaa
gtaacaccatcgtctacttttagaaagaagactggcgaagaaatatcatatgttcaatac
tacagaagtagatacaatctgaatataagagaaatgcgtcagccattgttggtatctaaa
tcaaaaccaagagatcgtcgggcaggaaaagaagaattggtatatctagtacctgaactt
tgccgaagcacaggtttaactgacctaatgcgaaataatttcagactaatgagcgcattg
gcccagtatactcgtgtctcgcctggcgataggattaaaaagttgatgagttttaacatg
cgtttacataatgtacccaatgtagtttctgagttaagcagctggaacctgcaacttgac
aggagattagttactctaacaggaagagttttgccagcagataatattgtttattatcaa
aacgaccaggttccagtgaacaataaagcaaactggacaaacgatttccgcaacaaaaag
ttgctcaaatgtggagttttagacaactgggtagttatagtaccggacagattaaaacgt
gactgtcagaactttgtaggacaaatgataagggttgcttcaacaatgggtttccgaata
gagcaaccttatgttagggaaattcgcaatgaccaggccgctagctatgcagatatatta
gaaaacattaaaagcacaagtaacccaatgctaatattctgtgtagcaacaaacaacaga
atggatagatatgcagcgattaagaaaaagtgctgtgtagatcgtccagtaccaactcaa
gttgttcttgcaaaatctttgcaaaataaaaatgccatgtcaattgctactaaaattgtt
attcaaatgaattgcaagataggaggaatcccgtggagcattccaattcctctaaaaggc
ttgatggttgttggttttgatgtgtgccatgacacgaattccaaagataaagattttgga
gctatggtcgcatccctcgatcctcactttgggcgatattttagtgcagttagcagtcac
actagtggtgaagaattatccaatgatctttctgttaatttgtgcaaagccttagctcaa
ttcaagcattacaacaatgctcttcctaaacgtatcgtgatttaccgcgatggtgttgga
gaaggacaagtaccaatggttttttcccatgaagtacaacaaataaaaaataagcttgaa
acagtttacgacaatgccgatgatgtcaaactagcttacgtgattgtaaccaaaaaaatt
aactcacgattgtttgctggaaatcaaaatccaccaccaggtactgtcatagatgacgtg
attaccgatcctacaaggtacgactttatgataatatcacaacatgtcacccaaggaacg
gttactccgactgcatataatatcatttacgatacttgcggtatggacgctgataagttg
cagcgtttaacttataagttgtgccacatgtatttcaattggagtggtactgtgcgagta
cctgcaccttgccaatatgctcataaattggcctttttggtggcacaagctgtacaccaa
tcgcctgatgttatgcttgaaacacttctgtactttttgtaa

DBGET integrated database retrieval system