KEGG   Nasonia vitripennis (jewel wasp): 100118462
Entry
100118462         CDS       T01081                                 
Name
(RefSeq) 60S ribosomal protein L36 isoform X1
  KO
K02920  large subunit ribosomal protein L36e
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
nvi03010  Ribosome
Brite
KEGG Orthology (KO) [BR:nvi00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    100118462
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:nvi03011]
    100118462
Ribosome [BR:nvi03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    100118462
SSDB
Motif
Pfam: Ribosomal_L36e
Other DBs
NCBI-GeneID: 100118462
NCBI-ProteinID: XP_001606808
NASONIABASE: NV13859
UniProt: A0A7M7GBS5
Position
2
AA seq 137 aa
MRAQSSRRGHHPFFACSHLHRMAPRYELAIGLNKGHKTTKIRVAKNKSEKEKTVAIRPAR
LKGRQTKHSKFVRDLIREVTGHAPYEKRAMELLKVSKDKRALKFLKRRLGTHIRAKRKRE
ELGNILVQMRKAAAQHH
NT seq 414 nt   +upstreamnt  +downstreamnt
atgcgtgcgcaaagcagtcggcgcggccatcatccttttttcgcgtgttctcatctccac
aggatggcacccaggtacgaattggccatcggcctcaacaagggtcacaaaaccaccaag
attagggtggcgaaaaacaaatccgagaaggagaagaccgttgccatcagaccagccagg
ctaaaggggcgtcagaccaaacacagcaaatttgtgcgagacttgatccgtgaagtcact
ggacatgctccctatgagaagcgcgctatggagttgttgaaggtttcaaaggataagcgt
gccctcaaattcttgaaaaggaggttgggtactcacattcgcgctaagaggaagcgtgag
gagcttggaaacatccttgtacaaatgaggaaggccgccgcacagcatcattaa

DBGET integrated database retrieval system