KEGG   Nasonia vitripennis (jewel wasp): 100118496Help
Entry
100118496         CDS       T01081                                 

Definition
(RefSeq) scoloptoxin SSD14 isoform X2
  KO
K18592  gamma-glutamyltranspeptidase / glutathione hydrolase / leukotriene-C4 hydrolase [EC:2.3.2.2 3.4.19.13 3.4.19.14]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
nvi00430  Taurine and hypotaurine metabolism
nvi00480  Glutathione metabolism
nvi00590  Arachidonic acid metabolism
nvi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nvi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    100118496
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    100118496
   00480 Glutathione metabolism
    100118496
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:nvi01002]
    100118496
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:nvi04090]
    100118496
Enzymes [BR:nvi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     100118496
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     100118496
    3.4.19.14  leukotriene-C4 hydrolase
     100118496
Peptidases and inhibitors [BR:nvi01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   100118496
CD molecules [BR:nvi04090]
 Proteins
  100118496
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-GeneID: 100118496
NCBI-ProteinID: XP_001602451
NASONIABASE: NV13150
Position
2
AA seq 613 aa AA seqDB search
MPRRDNLKFETLREQDRPCLTKKRMLIGGFILAGLLLIVILACSLSGRSGQSNREFVELV
PPDPEQPLPPSWSKLRSFKHGAVCADGEPCALIGKTILERNGSAVDAALAALICNGLINM
QSMGFGGGFIMTIYEKESNRAVILNARDAAPGAAHAYMYNGTVARASQAGPLAISVPGEL
AGYWEAHQRFGKLPWAEIFKPNIELCEKGYNLTNIQYDGLLSNKTKIFQDPYLKELFVNR
TTGTFYKAGTIIRPKKLCETMRIVAEKNATEFYNGTLGMTLVEDLRKRGSIITFKDLNDY
RAKWEDPVSTELYDGTKVYTPGLPASGGLLSLILNVFDEFHFTPNDLANTSSTIKTYHRM
IETYKYAYALRTELGDVKLPELFKNLTSKDYARSIRMMIRDNRTWEDPVHYGAPNFTNPD
DHGTAHISVIAANGDAVSVTSSINMYFGSGVASENTGVLMNSGMDDFGVPGLLSYFGIPS
NPNNYIAPGKRPLSSMSPTIFVDNNGDVKMTIGAAGGTKITTSIPFVIARHLWMGNTVKE
AVDAPRIHHQLYPMEVSYEYGVPKPVVDGLKALGHKTSRYRGRGSVICLLVRVNNTIYAN
ADHRKGGDVYGID
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atgccacgtagggacaatcttaagtttgaaactctgcgagaacaggacagaccatgtcta
acgaagaaacgcatgctgatcggtggcttcatactcgcaggccttctattgatcgtaata
ctagcgtgcagtttatccggtcgaagtggccagagcaaccgggaattcgttgagcttgtg
ccgccagacccagaacagccactgccaccgtcttggagcaagctcagatcgtttaaacat
ggagccgtttgtgcagatggcgagccttgtgctcttattggcaaaaccatacttgagcgt
aacggatcagccgtcgatgcggctcttgctgctctcatttgcaacgggctaattaacatg
caaagcatgggcttcggcggtggattcattatgacaatttatgaaaaagagagtaatcgt
gctgtgattttaaatgctagagatgctgctccaggagcggcacacgcctacatgtataac
ggaaccgtcgctcgcgcgtcacaggctggtccactggcaatatcagttcctggtgagttg
gctggctactgggaagctcatcaaagattcggcaaactgccatgggccgaaattttcaaa
ccgaatatcgaactctgtgagaaaggatataacttgacgaacattcagtacgacggtctt
ctttcgaataaaaccaaaatctttcaagatccttatttgaaagagctttttgtaaatcgt
acaacgggtacattttataaagccggtacaattattcgaccaaagaagttatgcgaaacc
atgagaatagtcgcagaaaaaaatgcgacggagttttacaatgggaccttaggaatgacg
ctagttgaagatctccgcaaacgcggaagtattatcaccttcaaagacttaaacgattat
agggccaaatgggaagatcccgtatcaacagaattatatgacggtacaaaggtctatact
ccaggtcttcctgcaagtggtggattgctatcgctcattctaaacgtttttgacgagttt
cattttacaccaaatgacttagctaatacgagttctacaataaaaacatatcataggatg
atagaaacttacaagtacgcttatgcccttcgaactgaattgggggatgtgaagctaccc
gagctatttaaaaatttaacgtcaaaagactacgctcgttcgataaggatgatgataaga
gataacagaacgtgggaagatcctgttcattatggagcaccaaattttacgaacccggac
gatcacggcacagcacatatttcggtcatcgctgcaaacggtgatgctgtgtccgttaca
agtagcattaatatgtactttggaagtggtgtagcaagtgaaaatacgggagtattgatg
aacagcggaatggacgattttggtgtgccaggccttttaagctatttcggtataccgtcc
aatccaaacaattatattgcgccaggaaagaggccattgtcatcaatgagtccaacgatt
tttgtggataataatggagatgtcaaaatgacaataggagctgccggtggcaccaagatt
actacatcaattccctttgtgatagcgagacacttatggatgggcaacacggttaaggaa
gcggtggacgcgccgcgaatacatcaccagctttacccgatggaggtgtcctacgagtac
ggagtgccaaaaccggtagttgacggactgaaggcccttggccacaagacttcgcgttac
aggggccgcggtagtgtcatatgtctgctcgtcagggttaacaacaccatctacgccaac
gctgatcaccggaaaggcggagatgtctatggtatcgattga

DBGET integrated database retrieval system