KEGG   Nasonia vitripennis (jewel wasp): 100118578Help
Entry
100118578         CDS       T01081                                 

Definition
(RefSeq) methionine--tRNA ligase, cytoplasmic
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
nvi00450  Selenocompound metabolism
nvi00970  Aminoacyl-tRNA biosynthesis
nvi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nvi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    100118578
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    100118578
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:nvi01007]
    100118578
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:nvi03016]
    100118578
Enzymes [BR:nvi01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     100118578
Amino acid related enzymes [BR:nvi01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   100118578
Transfer RNA biogenesis [BR:nvi03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    100118578
 Prokaryotic type
   Other AARSs
    100118578
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g WHEP-TRS tRNA-synt_1 GST_C_2 Anticodon_1 GST_N_5 tRNA-synt_1e GST_C_3 GST_C
Motif
Other DBs
NCBI-GeneID: 100118578
NCBI-ProteinID: XP_003425875
NASONIABASE: NV14554
UniProt: K7IZM6
Position
2
AA seq 968 aa AA seqDB search
MKAASNPNNPNLLKLIVAAEIAGKELTLDDKTEPKQSSLNRLPVLKLESSDELFSVSAAV
QYLAPVSEENIVAANRWLEWDASQLQPAIVSYGGSGKLDVSHKPRIWSLLKELNTALKDA
QYLIKDKDNLTVVDASIWVTLWSTVVVTEIGEVITKEFANVDKWLKDIQSLPAIQKSLKK
IKLERGVQAIISINAASWFPLNSYTGAGKSQSAPTGDGSPSEEKEDKAITQEEMDSVKNN
WTSITYSSIKEASYPVLPQKGEKNVLITSALPYVNNVPHLGNIIGCVLSADIFARYCRQR
NYNTLYISGTDEYGTATEAKALEEKLTPQQICDKFFDIHNDIYRWFSIGFDYFGRTTTPE
QTEIVQAMFLRIKEQGYILPKTVDQLLCEKCERFLADRFVEGTCPRCKYEDARGDQCDGC
GHLVNATELINPRCKVCSTKPVIKASTQFFLDLPKIQEGLKQWATEAEGGWSSVARAVTK
PWLRDGLKPRCITRDLKWGIPVPLDGYRDKVFYVWFDAPLGYLSITKKYTKEFEKWWKPN
GVDVSLYQFMAKDNVPFHAIMFPATLLAADQGHTLVRHIMATEYLNYEDTKFSKSRGIGV
FGTDARDTGIPADVWRFYLAYIRPETMDSNFNWVDLATKNNSELLNNLGNFVNRALMFAE
KNFNSKIPEMELLEDDLHVLALVQRELTSYITLLEQARLRDSLRHILAISKHGNQYMQSQ
QPWVKVKGSEEDKKKGATVIGVCCNLACLLSALLAPFMPNTARELRAQLGLPKQNYGYIP
EVLSIMLPAGHSIGKPSPLFTKIEDKQVEELRKKYAGRQESTPPRETVAVPTDVASLEAA
VAKQALLVRDLKAKQDKSVWQPQVQILLDLKKKLAEAQSKGNQAGAAKDNKAQSATAPQQ
NGNVTAEIAELEAAVLKQGNLVRDLKGKGDKSVWQPQVEILLQLKQKLSALTGAPAAAPA
DKKSKKKK
NT seq 2907 nt NT seq  +upstreamnt  +downstreamnt
atgaaggccgcttcgaacccgaacaatcccaacctcctgaagctcatcgtcgccgcggaa
atcgctggcaaggagctaacgctcgatgacaaaaccgagccgaaacagagctcgttaaat
cgactgccagtgctgaaattagaatcttcagatgagctgttcagtgtcagtgcagcggta
cagtaccttgcaccggttagcgaggagaatattgttgctgctaacagatggctcgagtgg
gatgcttcacagttgcagcctgcgatagtttcatatggtggatctgggaaattggatgta
tcgcacaagccccgaatatggtctcttctgaaggaactgaacacggcattgaaagatgca
cagtacttaattaaggataaggacaacctaacagtagtagatgcatctatctgggtgaca
ttgtggtctacagtagtggttaccgagataggtgaagtgattactaaagaatttgccaat
gttgataagtggttgaaggatattcaaagtttacctgctatccagaagtcattgaagaaa
attaagttagaaagaggagtccaagctattatttcaattaatgccgcatcttggttccct
ctcaattcatacaccggtgctggaaaatctcagagtgcaccaacaggcgatggtagccca
tctgaggagaaggaagataaagcaatcacgcaggaagaaatggattctgttaaaaataac
tggacatcgattacttattcctccatcaaagaagcttcttaccccgtgttaccacagaaa
ggagagaaaaatgttttaatcacttcagctcttccatatgtaaataatgttccacactta
ggaaatataattggttgtgttttgtctgcagatatctttgcaagatattgtcgacaaaga
aattataatactctctacataagtggaactgatgaatatggtactgcaactgaggctaag
gctcttgaagagaaattgactccccagcaaatctgtgacaaatttttcgacattcacaat
gacatttacagatggtttagtattggttttgattattttggtcgtacgacaacccctgaa
caaacggagattgttcaggctatgtttttaagaataaaggaacaaggctacattttgcct
aaaacagtggatcagttactttgtgaaaaatgcgaaagattcctggcggacagatttgta
gaaggaacgtgtcctaggtgtaaatacgaagacgcgcgaggtgatcaatgcgatggttgt
ggacatcttgtcaatgctacagaactcatcaatccaagatgtaaagtgtgtagcacaaag
ccagtaatcaaggcttcaactcaattctttttggatttacccaagattcaagagggtttg
aagcagtgggcaacagaagcagaaggtggctggtcatcagtagctcgcgcagttaccaag
ccttggttgagagatggtttgaaacccagatgtattacaagagatctcaaatggggaata
ccagtaccactggatggctacagggacaaggttttttatgtgtggtttgatgctcctctt
ggttatctcagtattacaaagaagtacaccaaggaattcgaaaagtggtggaaacccaat
ggcgtcgatgtaagcctttatcagttcatggctaaagacaacgttcctttccatgctatt
atgttcccagcaacgctcttggcagctgatcaaggtcacacgcttgtgaggcatattatg
gctactgagtatctcaactacgaagatacaaagttctcgaaatctagaggtattggagta
ttcggtacagatgcgagagatactggtataccagccgatgtctggcgtttctatctggct
tacatcaggccagaaactatggattccaactttaattgggttgatttagccactaagaat
aatagcgaattattgaataatcttggaaactttgtaaacagagctctcatgtttgcggag
aagaatttcaattcgaaaatcccagaaatggaattgctcgaagatgatttgcatgtcctt
gctctggtgcaacgggaactgactagttacattacccttttggaacaagcaagattacgt
gatagtttgagacacatattagctatttctaagcatggaaatcagtacatgcagtcccag
caaccatgggtcaaagttaaaggaagtgaagaagacaagaaaaagggagcaactgttata
ggtgtttgctgcaatctcgcctgtcttctgtctgcattgctagccccattcatgccaaac
acagctcgggaattgagagcgcaattgggattgcccaaacaaaactatggctatattccg
gaggttctctctatcatgctgccagccggtcacagtattggcaaaccttctccgttattc
acgaaaatagaggataagcaagttgaggagttaagaaaaaaatacgctggaagacaagag
tcaacacctcctagagaaaccgtggcggtgccaactgacgtcgcatctttagaggcggcg
gttgcgaaacaagccttactagtcagagatcttaaagcaaaacaagataaaagcgtttgg
caaccacaagtacagattcttttggatttaaagaaaaagctagccgaagctcaaagcaag
ggtaaccaagctggagcagcaaaagataacaaagcgcaatcggcaacagctcctcaacag
aacggcaatgtaaccgcagaaattgctgagctagaagcagcagtattaaaacagggcaat
cttgttagagacttgaagggtaagggtgacaagagcgtgtggcaaccccaagtggaaatt
cttctgcagttaaaacaaaagttgtccgcactgacaggcgccccagccgcagcgccggcc
gacaaaaaatctaaaaagaaaaagtaa

DBGET integrated database retrieval system