KEGG   Nasonia vitripennis (jewel wasp): 100118971
Entry
100118971         CDS       T01081                                 

Name
(RefSeq) plexin-B
  KO
K06820  plexin A
Organism
nvi  Nasonia vitripennis (jewel wasp)
SSDB
Motif
Pfam: Plexin_cytopl Plexin_RBD TIG TIG_2 TIG_plexin Sema PSI
Other DBs
NCBI-GeneID: 100118971
NCBI-ProteinID: XP_016844903
NASONIABASE: NV12162
UniProt: A0A7M7IV19
Position
5
AA seq 2014 aa
MNLFGLWSISLRPLVPPPPRLTQLLILYYACLVLCLIPLQAVSATSEEVAGSASASNETQ
LVHIVAQFPSLASGQMQRTYLDYNSTSLRFNHLVIDPNTGQLFAGAVNRLLQLDSDLQVK
EHVITGPKHDNPQCHATGCSSTDIETSLTDNVNKLLVADLDTRTLIVCGSLFQGACEKHR
MSNISLKLQNFTFGVAANDEASSTYAFIGPARYNAWQSSNILYVGTTFTNNAEYRHDVPA
ISSRNLDNLEFAEYTFNKQSILHIDVKYRDHFLVKYVYGFNASTYAYFVLVQKQSYLPEE
EELGYISRIARSCITDPNYDSYTEVTLQCNVEGRNESYKLVQDAKIGTASSDLASQLGIS
AGSSIFVATFSPSKGITNEPLPKSAICVYSLQDIENKFDENIHMCFNSSIKYRNMGYISG
PIQDGECPQSTGNIGDFCEVGLKISGVSPIVGQAVLHFPDTFVTSITLANTESHTVAFLG
TEDGAVKKVLLSASDASVYESIVVDKGQKILPDTAVAPSGDYLYVLSNSRISKVKVQHCS
SYTNCNSCLVAGDPYCGWCSLEKRCTVRRDCQKANRSSPRWLSLGTGQQCIDFEQVLPDR
IPIKQMTTVQLTIRTLPELPTGAKYKCVFGKAEPIDAIMTMYGLSCPTPPIYSRPNIPKD
ADHVLVPLSVRSSETNKDFVSRNFAYFDCSKHTICSECVKAQWTCSWCVYDNKCTHNTTE
CQGDIISGENNVQATLAAHGAQYCPRFVTPEKPLMLPNNVPKEITLEVKNLPHPQVGHTG
FQCFVNIEGAHLRVQARAESSRYIICDKTVYSYEAQTGEYEAEVMVMWNSNHYIDRTSII
LYKCEVLGSHREHADCSLCVTRERHFQCSWCGSSCVYRDSCLNSAFTECPKPRIDMIKPL
SGPIEGGTLVTIEGSNLGLRESDVAGKIFIGNATCTLVDYEISVRIVCRTSQHEATDEAA
VIVGNVAGFTRSAVYFSYKDIRLTSLNPRVGPQSGGTRLAITGQYLNIGSAISAYLDELP
CQVNASQASSTRLTCVSSRSGRVRSISRLTLSIDGANRTLEGNPYNYTHDPSIMEIKPLS
SFASGGRMITVHGTYLDTIQKPEMVVYFDKESVPINRTICSVLNPTQMECPSPSVAGRFG
IARDKRSLGRKVASLSLKIGFIMDNVESVRDLDKHSQNLRNRLVYVEDPKFFPFPSNVKL
YKGDTLVIEGESLNYASDESDVMVTVGTQPCNVTSLAFSQLVCTPPDQQPMGTDEHGVKT
EDGLPLVVVRVGKSLRFPIGYLHYDLIKSYPIPPEAIAGIAAGTFGLVFIFILVLVIYRR
KSTQAEREYKRIQIQMDTLESNVRMECKQAFAELQTDMTDLTADLESTGIPTLDHKNYIM
KVFFPGVIDHPILNDPRSRNNLTRTNYDAAMLQFEQLINNKCFILTFIETLESQKDFNIR
DKVNVASLLMVVLMGKMEYATDILMNLLLRLIDKSVNTKHPQLMLRRTESVVEKMLTNWM
ALCMYNYLKDYAGSSLFLLFKAIKHQIEKGPVDVVTHDARYSLSEERLLREQIDHSIVTL
HVVQDDLDEKIQCKVLDCDTISQVKSKILDALYKNTPFSLRPSVHEVDLEWRHGRGGHLT
LQDEDLTTKCCGDWKKINTLAHYGVKESAVMSLIPRQNDGFSLSCKQPCHTCSKTSQHHM
QQHIQHPSQQQHHYHSRHAINHCSTLHLPPTPNHGLLSPATMYATGPGIYFDSQHSPPMI
IANGDVETGHTGSQRLYHLVRPVEESQYATSMGFASGKVPPGLHPERTHKAIPEIFLTRL
LSTKGTVQKFVDDFLNTILTANDALPSAVKWLFDLLDEAANKHNILDPEVPHAWKSNSLP
LRFWVNFIKNPDFMFDINKSTTVDSSLSVIAQTFMDACSTSEHRLGKDSPSNKLLFAKDI
PHYREKVGRFYAEVQRLPLITDQEMSSAMQQLSASHANEFDVIAALKELYIYVSKYYGEI
LEALETDPGCCKLHLAHRLENVACTLEGEETSAC
NT seq 6045 nt   +upstreamnt  +downstreamnt
atgaatctctttggactatggtccatctccctgcgaccactggtgccaccgccaccacgg
ttgacacagttgctcattctctactatgcctgtcttgtactctgcttgatccctcttcaa
gcagtgtcagccacctctgaggaagtagctggttccgcatctgcttccaatgaaactcag
cttgtacacatcgtggcacagtttccatcattggcttctggacagatgcaaagaacctac
ttggattataattccacttctctacgcttcaaccaccttgtgatagatcccaatactggt
cagctctttgctggtgctgtcaacaggctattgcagctagactctgatctccaagtaaaa
gagcacgtgattacaggtcctaagcacgacaacccgcagtgccatgcaacaggatgttcg
tccacggacatcgagaccagcttgaccgacaacgtaaacaagctactagtagcggatctg
gacacacgaaccctcatagtctgcggctcgttgttccaaggcgcgtgcgaaaagcaccgg
atgtccaacatatccctcaagctacagaacttcacgttcggcgtcgcagcgaacgacgaa
gcttcctctacctatgcttttatcggtcccgcgcgttacaatgcttggcagagctcgaac
atcctctacgtcggcacgaccttcactaacaatgccgagtaccgacatgacgtgcctgct
atttctagtcgtaatttggataatttggagttcgccgagtatacctttaataagcagtcc
attcttcatatcgacgtgaagtaccgtgaccattttctcgttaaatatgtctacggattc
aacgccagcacctacgcttacttcgtcctcgtccaaaaacagtcttacctgccagaagag
gaagaacttggttatatatcgaggatagctaggagctgcatcactgatccgaactacgac
agctacacggaggtgacgctccagtgcaacgtagaaggcagaaatgaatcgtacaagctt
gtgcaagatgcgaaaattggaactgccagtagtgacctagcttctcagttaggaatcagt
gctggctcttcgatttttgtcgctaccttctcacctagtaagggtatcaccaacgagcct
ctgccaaagtctgcaatatgcgtctacagtctccaggacatcgagaacaagtttgacgaa
aacatccacatgtgcttcaacagtagcatcaagtacaggaacatgggctatattagcgga
cccatccaggacggcgagtgtccgcagtccactggaaatattggagacttctgtgaagtt
ggattaaaaatttctggtgtatctccaattgttggtcaagcagttttacactttcctgat
acttttgttacttctattaccttggcaaacacagagagtcatactgttgcttttttgggt
acagaagatggtgctgtaaagaaagttttactttctgcgtcggatgcttcagtttatgaa
agcatcgtagtagataaaggtcaaaaaatccttccagatactgccgttgcaccaagtgga
gactacctttacgttctatcaaattctcggatttcaaaagttaaggtgcaacactgtagt
agttacacgaattgcaatagctgtctagtagctggagatccgtattgtggttggtgctct
ttagaaaaaagatgtactgtacgtcgagactgtcagaaagcgaatagaagtagtccacgc
tggctgtctctgggaactggacagcaatgcatcgattttgagcaagtgcttccggatcgc
atacccatcaagcagatgacgacggtacaactgactattagaacactgcctgaactgcct
actggtgcaaagtacaaatgcgttttcggcaaagccgaaccaatagatgccattatgacc
atgtatggtctgtcctgtccgactccacctatctactctagacccaacatccccaaggat
gctgatcacgttctcgtgccattatccgttcgctcgagtgaaactaacaaagactttgta
tcgcgtaattttgcctacttcgattgctcgaagcatacgatttgctccgagtgcgttaaa
gcgcaatggacttgcagctggtgcgtctatgataataaatgcacgcacaatacgactgaa
tgtcaaggtgacataatttctggagaaaataatgtacaagcaacccttgcagcacatggg
gctcagtattgcccacggtttgttactccggagaaaccgctcatgctgccaaacaacgtt
cccaaagagatcaccctcgaagtgaaaaatctgccgcatccacaagtcggtcacaccggt
ttccagtgttttgtaaatatcgaaggtgctcatttgcgcgtccaagcccgagctgaaagc
agtcgttacatcatttgcgacaaaacagtatattcttatgaagcacaaacgggcgagtac
gaagccgaggtgatggttatgtggaactcgaatcactacattgaccgcaccagcatcata
ctgtacaagtgcgaagtattgggttctcaccgagagcatgcagattgttcgctctgcgtc
acccgtgagcgacacttccagtgtagctggtgcggcagtagttgcgtttatcgagactct
tgcctgaattccgcattcactgagtgtccaaagccacgtatcgacatgataaaaccgctg
agcggacctatcgagggtggcactcttgtcaccatagagggtagcaatttaggtctacgt
gaaagtgacgtcgctggaaaaatttttatcggcaacgctacctgcactctcgttgattac
gagatttcagtccgtattgtctgtcgcacaagtcaacacgaggccaccgacgaagctgct
gttatcgtaggtaacgtcgccgggtttactcgcagtgccgtttacttcagctacaaagat
atccggctaaccagtctgaacccacgggtcggtccacaaagcggaggaacacgtcttgct
atcactggccaatatctcaacatcggcagtgcgatatcagcgtatctggatgaactgccc
tgccaagtgaatgccagccaggctagtagtacacgactaacttgtgttagtagcaggtct
ggtcgcgtgcgaagcatatctagactgacgctgagcattgacggggcgaaccgtactctc
gagggcaacccttacaactacacgcacgatcctagcatcatggagatcaagcccttgagt
agcttcgcttcaggaggtcgtatgattacagtccacggcacgtatctcgacaccattcaa
aaacccgagatggtcgtgtattttgacaaggagagcgttccaattaatcgcacaatttgt
tcggtgctcaatccgacgcagatggagtgtccaagcccaagtgtggctggacgcttcggt
atagctcgtgacaagcgttctcttggacgtaaggttgccagcctctcgctcaagatcggc
ttcatcatggataacgttgagtcggtgcgcgacctcgacaagcactcgcagaacctccgc
aatcggctcgtgtacgtcgaggaccccaagttcttcccgtttcccagcaacgtcaagcta
tacaaaggtgatactttggtcattgagggagagagtctgaactacgcgagcgacgagtcc
gacgttatggtgacggtcggtacccagccctgcaacgtcacgtcgctggctttctcacag
ttggtttgcacgcctccggatcagcaacccatgggtaccgacgaacacggggtgaagact
gaagacgggctgccgcttgtagtcgtgcgcgtcggcaagagtctcaggttcccgattggt
tacctccactacgatctcatcaaatcctacccgataccgcccgaggcgatcgcgggtata
gccgcgggcactttcggcctcgtcttcatcttcatactggtgctcgtaatctatagacgc
aagagtacacaagctgagagggagtacaaaaggatacagatacagatggatacgctggag
agtaacgtgaggatggagtgcaaacaggccttcgccgaactacagaccgacatgacggat
ctcaccgcggacttggagtcgaccggtataccgaccctcgatcacaagaattacatcatg
aaggtcttcttcccgggagtgatcgaccatccgatcctgaacgaccctcgttcacgcaac
aatctcacgcgcaccaactacgacgcggcgatgctgcagttcgagcagcttatcaacaac
aagtgcttcatcctgacgttcatcgagacgctcgagtcccagaaggacttcaacattcgg
gacaaagtgaacgtcgcctcccttctcatggtcgtcctcatgggcaagatggagtacgca
acggatatcctgatgaatctactgctgaggcttatcgacaagtccgtcaacacgaagcat
ccccagctgatgttgaggcgcaccgagtccgtcgtcgagaaaatgctgaccaactggatg
gccctgtgcatgtacaactacctcaaggactacgccggctcgtcgctctttctcctcttc
aaggccataaagcaccagatcgagaaaggtcccgtcgacgtcgtcacccacgacgccagg
tactccctctccgaggagcgactgctgcgcgagcagatcgaccacagtatcgtcacactt
cacgttgttcaggacgacctcgacgaaaagatccagtgtaaagtcctcgattgcgacacc
attagccaggtcaaatccaagatactcgacgccctctacaagaacacacccttctcttta
aggccttcggtgcacgaggtcgacctcgagtggcgccacggcaggggcggccaccttacc
cttcaggacgaggatctgacgaccaagtgttgtggcgactggaagaagatcaataccttg
gctcactatggagtcaaggagtccgctgtcatgtcgctcattccgcggcagaacgatggc
ttctcgctctcctgcaagcagccctgtcacacttgtagcaaaacgtcacagcatcatatg
cagcagcatatacagcacccaagtcaacagcagcaccactaccactcgaggcacgcgatc
aaccactgttctacgttgcatctaccgccaacgccgaatcacggtctcttaagtcccgcg
acgatgtatgccaccggccctggcatttacttcgacagtcagcactcgccgccgatgatt
attgccaacggcgacgtcgaaaccggacacaccggcagtcagcggctctatcacttggtg
aggccagtagaggagagtcaatacgcgacgagtatgggcttcgcgagcggtaaggtaccg
ccaggtctgcacccggagcgcacccacaaagcaattcccgaaatcttccttacgaggctg
ctctcgaccaagggcaccgtacagaagtttgtcgacgactttcttaacacgatactgaca
gcgaacgatgcgctacccagtgccgtcaaatggctcttcgacctactcgacgaggcggcc
aataagcacaacattctcgaccccgaggtaccccacgcttggaagtccaacagtctgccg
ttgcggttctgggtgaacttcataaagaatccagacttcatgttcgatatcaacaagtcg
acgacggtggactcaagtctgtcagtcatcgctcagactttcatggacgcatgctcgacg
tcggagcacaggctcggcaaggactcgccctcgaataaactgctcttcgccaaggatatc
ccacattacagggaaaaagtgggcaggttttatgccgaggtgcagagattaccgctcatc
acagatcaagagatgtccagtgccatgcagcagctaagcgcctcgcacgctaacgagttt
gatgtcattgccgcactcaaagagttgtatatctacgtcagcaagtactatggagagatc
ctcgaggcgctagaaacggatccgggctgctgtaaactccacctggcccatcggctggag
aacgtcgcttgcactctcgaaggcgaggagacgagcgcctgctga

DBGET integrated database retrieval system