KEGG   Nasonia vitripennis (jewel wasp): 100118978
Entry
100118978         CDS       T01081                                 
Name
(RefSeq) nucleoside diphosphate kinase 6 isoform X1
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
nvi00230  Purine metabolism
nvi00240  Pyrimidine metabolism
nvi00983  Drug metabolism - other enzymes
nvi01100  Metabolic pathways
nvi01232  Nucleotide metabolism
nvi01240  Biosynthesis of cofactors
Module
nvi_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
nvi_M00050  Guanine ribonucleotide biosynthesis, IMP => GDP,GTP
nvi_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
nvi_M00053  Pyrimidine deoxyribonucleotide biosynthesis, CDP => dCTP
nvi_M00938  Pyrimidine deoxyribonucleotide biosynthesis, UDP => dTTP
Brite
KEGG Orthology (KO) [BR:nvi00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100118978
   00240 Pyrimidine metabolism
    100118978
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    100118978
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:nvi04131]
    100118978
Enzymes [BR:nvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     100118978
Membrane trafficking [BR:nvi04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    100118978
SSDB
Motif
Pfam: NDK
Other DBs
NCBI-GeneID: 100118978
NCBI-ProteinID: XP_031778931
NASONIABASE: NV13742
Position
2
AA seq 190 aa
MTNYRMSSRPSLQLTLAILKPHVVKSPFALQKIRDIILQNDFKIVRTRRTIIDIKEAEEF
YKEHKEKFFYNRLLTFMCSGPSDVHILANENAIVKWRQLLGPTKVFQAQYSAPNSIRGMF
GLSDTRNAAHGSDSPESTEREIKVFFPDFNIKEWYKNEEMFFSSGKLRLDPDLFVHIVDK
NVLNVTENKS
NT seq 573 nt   +upstreamnt  +downstreamnt
atgaccaattatagaatgtcatctcgaccttctttgcaattgacacttgcaatactcaag
cctcatgttgttaaatctcctttcgcattgcagaaaataagagacatcattcttcaaaac
gattttaaaattgtaaggacacgaagaacaattatagacattaaagaagccgaagaattt
tacaaagagcataaagaaaagtttttctacaacagactattaacgtttatgtgtagtggt
ccttccgatgttcatatattagctaatgaaaatgctattgttaaatggcgtcaactttta
gggccaacaaaagtatttcaagctcaatactcagcacctaattcaattagggggatgttt
ggattgtccgatacaagaaatgcagctcatggctcagattcaccagaatcaacagaaagg
gaaataaaagtgttttttcctgacttcaatatcaaagagtggtacaaaaatgaagagatg
ttcttttcatcaggaaaattacgattggatccagatttatttgtacatattgttgataaa
aatgttttaaatgttacagaaaataaatcctaa

DBGET integrated database retrieval system