KEGG   Nasonia vitripennis (jewel wasp): 100118996
Entry
100118996         CDS       T01081                                 
Name
(RefSeq) tyrosine-protein kinase hopscotch
  KO
K04447  Janus kinase 2 [EC:2.7.10.2]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Brite
KEGG Orthology (KO) [BR:nvi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nvi01001]
    100118996
Enzymes [BR:nvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     100118996
Protein kinases [BR:nvi01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   100118996
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase FERM_F1 RIO1 Jak1_Phl FERM_F2 ABC1 SH2 Kdo Pkinase_fungal APH
Other DBs
NCBI-GeneID: 100118996
NCBI-ProteinID: XP_001602854
NASONIABASE: NV16630
UniProt: A0A7M7G3M8
Position
3
AA seq 1141 aa
MEEDKLAVINVATEVKIINITYVTGWTAEDLCIKVCQYFGIGPVARHLFALRNRSTKLWY
HSAYKFDGKEKHKFDFRLRFKPSSLRRLKQLDVRAYDYYFQQARGDVLENKVPDIVYERH
RRELIGLGVCDMYRVMLEKDVAREIVESDYKKYIPKECIKRHSFFIRKPIHNALARISGH
DASFVKEQYLNQFESMAPNYLCEEYKALIDKGMTSPPLRVLLRINATDIKYCQIEESNSN
WKVLCAIEDLCFVSIRQDNTVEVSRKNGIPSYLKFSTNSLLMSFVSALDGYYRLSIKWTF
NLCGDAVTPSLERLHRLKCHGPVGGEFSYSKLEDKRANRAGTFILRESESKYDAYYLDAC
GRDSKPRTRKIEKIGPEDFALSESMQRFRSIAQLIAAHQDPEGALYLNECLPPSEYDKSP
LLICAPEGYGSDVAADEEIIAGVLEGRPCCVPPHELQVYKAQPFPKSKESQARLNSSSCG
GPTTTLYRAMWRVTKGKRLETAIKLLKEDEGQPTKEFLKLAQKWGQLRSSALVRLYGVTL
APSVGMLLELVKLGALDAYLRNNSPQTIKTVDMVEAAACLATAVWHLEENGVVHGNIRCR
KLLVHAHTDNSFIVKLADPGIFSYKPADVHWLPPECYGNPDLARRSIQADVWAIATTLWE
IFSRGTILPSNTEPDPIKKFYASGKRLPIPNGCPPEVYKLMTDCWGEIGGSRKQPQAIMR
DINQIKYQVYNSRRTHAYATAFPKRANDSELIDDDFSEVTEHNSSSDCESRASSLFTDRT
SLPWDDSEDNTRGLAHMEWSGVPFEDTEDVLSTYLGWWAKTSGDNADNGYDHDGGLLGQM
QSIFELDADCNVILQGRIGQGFYGEVYLGICEKDSVKDAEPQQVAVKKLKMRALEADLRD
FEREIEIMKTLKHPNVVGILGVISEPEVCLVMEFVKHGSLQSYLAIHRESLTNKRLLGFA
LDIATGMEYLGRMNIVHRDLAARNILVADDNRVKISDFGLAQVTGKNDYYILQTNRDLPI
KWYAPESLRDGKFSPRSDVWSFGVTMYETFSFGEDPKLPEFGSNSVVEVEGSGKAVNTLE
EEGGADLLKALERGARLPCPATCPQEVYTKVMYPCWNIQSHERPEFAKLCKDIRDLINNE
Y
NT seq 3426 nt   +upstreamnt  +downstreamnt
atggaggaggataaactagcagtaataaacgtggccacagaagtgaagataataaatatt
acttatgtcacaggttggactgcggaggatttgtgcattaaggtatgtcaatattttggt
attggcccagtggcaagacatcttttcgcacttagaaatcgttctacaaaactttggtat
cattcagcatacaaattcgatggaaaagaaaagcacaaatttgacttccgcttaagattc
aaaccatctagtcttcgtagattaaaacagttagatgttagagcttatgattattatttt
caacaagcaagaggcgatgtactggaaaacaaagttccagatattgtgtatgaaaggcac
aggcgtgagctcataggtttaggtgtttgtgatatgtatagagttatgttggaaaaagat
gttgcacgtgaaattgttgaatctgactataaaaagtatataccaaaggaatgtataaaa
agacattctttttttataagaaaaccaattcataatgctttggctcggatatctggacat
gatgcttcttttgtcaaagagcaatacctcaatcagtttgaatctatggctcctaattat
ttatgcgaagagtataaggctttaattgacaagggaatgaccagtccaccgcttcgtgta
cttttaaggataaatgctacagacataaaatactgtcaaattgaagaaagtaatagtaat
tggaaagtattatgtgctatcgaagatctctgtttcgtttccatcaggcaagataatact
gtagaagtatcgagaaaaaatggaataccatcgtacttgaaattcagtacaaattcatta
ctcatgtcatttgtctcagcacttgatggatattatcgtttatctataaaatggacattc
aatctttgtggtgatgctgtgacgcctagcttagaacgtttacataggctaaaatgccat
ggacctgttggtggggaattttcatattcaaaacttgaagacaagagagccaacagagca
ggaacgtttattttgcgagagagtgaatctaaatatgatgcatactatttggatgcttgt
ggaagagattccaaaccacgaactcgaaagatagaaaaaatcggacctgaagattttgct
ctatcagaatccatgcaacgatttagatccattgctcaattgattgctgctcaccaagac
cctgaaggtgcattatacctgaacgaatgcttgcctccttcagaatatgataaatcgcca
ttgctaatatgtgctcctgaaggatatggaagtgatgtagcagctgatgaagaaatcatt
gccggagttttagaaggaagaccgtgttgcgtaccaccgcatgaattgcaggtttataaa
gctcaaccttttcctaaaagtaaggaaagtcaagcgcgtttaaattcgtcatcttgcggt
ggtccgaccacaactctttatagagcaatgtggcgcgtgaccaaaggcaagaggctagaa
accgcaatcaagttattaaaggaagatgaaggacaacccacgaaagagtttttgaaacta
gcacaaaagtggggtcaactgcggtcaagtgctctagtaagattgtacggcgtaactctt
gctccgtcagttgggatgcttttggaacttgtcaaattaggagctttagatgcttattta
cgtaataattctccacaaaccattaagactgttgacatggttgaagctgcagcttgtctt
gctactgccgtttggcatttggaggaaaacggagttgtacacggaaatattcgatgtcga
aaattattggtacacgcacacaccgataacagttttatcgtgaaattagccgaccctgga
attttcagttataagccagccgatgtccattggttgccgccggaatgttacggaaatcca
gatttggcgagacgaagcatacaggccgatgtttgggccatagctacaacgctatgggaa
atattttcacgaggaactattttgccatcaaatactgagcccgatcctattaagaagttt
tacgcaagtggaaaacgtctacctataccaaatggctgtccaccagaggtttataagctt
atgacagactgctggggcgaaataggaggttcgaggaaacaaccgcaagccataatgcga
gacatcaatcaaataaagtaccaagtgtacaattcaagaagaactcatgcgtatgctacg
gcgtttccaaaacgagcaaacgattcggaacttatcgatgacgattttagcgaagttact
gagcataattcatcgtcggattgtgaatcaagagctagcagtctttttacggatcggaca
agcctcccatgggacgattctgaagataatacgagaggtctggcgcatatggaatggagc
ggtgtaccttttgaagacaccgaggatgttctttcaacctatttgggttggtgggcaaaa
actagtggcgataatgccgataatggatacgaccacgatggtggcttgttgggacagatg
caaagcattttcgaattggatgccgattgtaacgtaattctgcaaggccgcataggccaa
ggcttctacggtgaagtctatttgggaatatgcgaaaaggatagtgtaaaagatgccgaa
cctcagcaggtcgcagttaaaaagttgaaaatgcgagctcttgaagctgacttgcgggac
tttgaaagagaaatagaaataatgaagactttgaagcatcccaatgttgttggaatattg
ggcgttatttcggaaccggaggtgtgcttagttatggaattcgttaagcacggttcatta
caaagttatcttgccatacatcgggagagcctcactaataaaagactgttaggctttgcc
cttgatatcgctaccggcatggaatatctcggtcgcatgaatattgtgcacagagatctt
gctgcaagaaatattctcgttgcagatgataatagagtgaaaattagcgacttcggtctt
gcccaagtaactggcaaaaatgattattatatattacaaaccaatagagatcttcccatc
aagtggtatgcgccagaaagtttaagggatggaaaattctcacctcgctcggatgtttgg
tcgttcggtgtgacaatgtacgagacttttagttttggtgaagatccaaagttaccggaa
tttggtagtaatagcgtagtcgaagttgaaggatccggtaaggctgttaatactttagaa
gaagaaggaggcgcagacttattaaaagctctggaaagaggtgcacgactaccttgtcca
gcaacatgtcctcaagaagtgtacacaaaagtaatgtatccttgctggaatattcagagc
cacgaacgtccagaatttgcaaaactctgcaaggatattcgggatttgattaacaatgag
tattaa

DBGET integrated database retrieval system