KEGG   Nasonia vitripennis (jewel wasp): 100119020Help
Entry
100119020         CDS       T01081                                 

Definition
(RefSeq) cytosolic 10-formyltetrahydrofolate dehydrogenase
  KO
K00289  formyltetrahydrofolate dehydrogenase [EC:1.5.1.6]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
nvi00670  One carbon pool by folate
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    100119020
Enzymes [BR:nvi01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.6  formyltetrahydrofolate dehydrogenase
     100119020
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh Formyl_trans_N Formyl_trans_C PP-binding DUF1487
Motif
Other DBs
NCBI-GeneID: 100119020
NCBI-ProteinID: XP_001602871
NASONIABASE: NV10044
UniProt: K7ILV9
Position
1
AA seq 902 aa AA seqDB search
MRKLKVAIIGQSNFAAEVYKSLKRDGHEVTGVFTIPDKVNREDPLAITAKADGTPVFKIK
AWRSKGLPLPEVLDLYKSIEVDLNVLPFCTQFIPMEVINHPKHRSICYHPSILPRHRGAS
AISWTLIEGDEVAGFSVFWADDGLDTGPILLQRSCPVKPNDTLDSLYNGFMYPEGIKAMA
EAVNLVAKGTAPCVPQTEEGATYDAMLNKKELQRLDWKGKSAKQAHDFIRALDSTPGAWT
LIDGEEARLYGSSLWKGNETIPSGTAVDIDGRPAVVHETGLLMQAEDGNWLNVEVLKIGT
RTISASKYGQAQSNGTCLEFTEEERQAVETIRKIWQSILRRDIDDDTDFFACGAGSMDVV
RLVEEMKDSLDIHLQNTDVFMAPVFMELVNSAILAKRGASASQNIAYEAVVLQANNMDLS
FPRQLFVNGKFVNGRGKPIVSVNPHDESVICSVESASIEDVDEAVKAAKKAFEEGEWSKI
SARERGALLFKLADLMEQHKEELATLESLDSGAVYTLALKTHVGMSIETWRYFAGWCDKI
QGATVPISHARPNRNLTMTRKEPIGVCGLVTPWNYPLMMLSWKMAACLAAGNTVVMKPAQ
TSALTALKFAELSAKAGIPPGVINIVPGSGSITGNAIVNHHLVRKLGFTGSTEIGQMIMR
SCADSNLKKVSLELGGKSPLVIFEDADMQQAVRLAMSSVFFNKGENCIAAGRIFVEERIL
DEFLDRVVAETKKIAIGDPLNRGTSHGPQNHKAHLDKLLEFVEKGVKEGARLVYGGRRLD
RPGFYFEPTIFADVRDGGFLATEESFGPIMIVSSFSSNDLDKVIARANATEYGLASGVLT
KDISRALRFAEKIDAGTVFVNTYNKTDVAAPFGGFKRSGFGKDLGQEALNEYLKTKTITI
EY
NT seq 2709 nt NT seq  +upstreamnt  +downstreamnt
atgaggaagttaaaggttgccattatcggccaaagcaacttcgcggctgaggtctacaag
tcattgaaaagggacggacacgaggtcaccggagttttcacgataccggacaaggtcaat
cgcgaggatccactggcgataacagcgaaggccgatggcactccggtcttcaagatcaag
gcctggcgcagcaagggtctacctctgccggaggtcctcgacctctacaagagcatcgag
gtcgacctgaacgtgttgcccttttgcacccaattcatacccatggaagtgatcaaccat
cccaagcatcggagcatctgctaccatccgtcgattctgccaaggcatcgtggcgcgagt
gccatcagctggactctgatcgaaggcgacgaggtggccggtttctcggtcttctgggct
gacgacggcctggacaccggaccgatcctcctccaacgcagctgtcccgtgaagcccaac
gatactctggacagtctgtacaacgggttcatgtacccggagggtatcaaggcgatggcc
gaggcagtgaacctcgtggctaagggtacagcgccgtgcgtacctcagaccgaggaaggc
gcgacctacgacgctatgctgaacaaaaaggaactgcagaggctcgactggaagggaaaa
agtgccaagcaggcgcacgattttatcagggctttggactcgacaccaggtgcttggacg
cttatcgacggcgaggaggcgaggttgtacggcagcagtttgtggaaaggaaacgagaca
ataccctcgggaacagcagtggacatcgacggccggccagctgtggttcacgagacgggt
ctgctgatgcaggcagaggacggaaactggctgaacgtcgaggttctgaaaatcggtacg
cgtacgataagcgcaagcaagtacggccaggctcagagcaacggcacctgtctcgagttc
acggaggaggagcgacaagctgtcgagaccatccgtaaaatctggcaaagcatactgcgc
cgggatatcgacgacgataccgatttcttcgcttgtggtgccggcagcatggacgtcgtc
cgtctggtcgaggagatgaaggacagcctggacattcacttgcagaacaccgacgtgttc
atggcgccggttttcatggaactggtaaactcggcgatactggccaaacgcggagcaagc
gccagccagaacatcgcctacgaggcggtcgtgctccaagcgaacaacatggacctgagc
ttcccgagacagctgttcgtcaacggcaagttcgtcaacggtcgtggaaagccgatcgtc
tcggttaacccgcacgacgagagcgtcatctgctcggtggaaagcgcctcgatcgaggat
gtcgacgaggcggtcaaggcggccaagaaggctttcgaggagggagagtggagcaagatc
agcgcgagagaacgaggcgctctgcttttcaagctagccgacctgatggagcagcacaag
gaggagctagccaccctggagagtctcgactccggcgcggtgtacaccctggccttgaaa
acccacgtgggcatgtcgatcgagacatggcgctacttcgccggctggtgcgacaagatt
caaggggctaccgtaccgatctctcacgcccggccgaatcggaacctgacgatgacgcgg
aaggaaccgatcggagtctgcggccttgtcacgccctggaactacccgctgatgatgctc
tcctggaagatggctgcttgtctggcggctggaaacactgttgtcatgaaacctgctcag
acctcagcactgacggcgctcaagtttgccgagctgtccgccaaggccggcattccacca
ggtgtgataaacatcgttcccggaagcggttcgatcaccgggaacgccatcgtcaatcac
cacctcgtgagaaagctcggattcacaggatcgacggaaatcggccagatgataatgcga
tcgtgcgccgacagtaatctgaagaaagtctcgctcgaactcggcggaaagagtccactg
gtgatattcgaagacgccgacatgcaacaagccgtcagacttgcaatgagcagtgtcttc
ttcaataaaggagagaactgcattgctgccggtcgaatcttcgtggaagagcgcatcctc
gacgagttcctggatcgcgtggtcgccgagacgaagaagatcgcgatcggcgaccccttg
aaccgtggcacctcccacggaccccagaaccacaaggcccacctcgacaaactcctggaa
ttcgtcgagaagggagtgaaggaaggcgcgcgtctggtgtacggtggccgcagactcgac
aggcccggtttctacttcgagcccacgatcttcgccgacgttcgcgacggcggcttccta
gcgaccgaggagtccttcggacccatcatgatcgtctcgagcttcagctccaacgacctg
gacaaggtaatcgccagggctaacgcgaccgagtacggacttgcttctggagttctgacc
aaggacatcagccgagcgttgaggttcgcggagaagatcgacgccggtacggtgttcgtt
aacacttacaataagaccgacgtggctgcgccgtttggagggttcaagaggtctggattc
ggaaaggatctgggacaggaggcgcttaacgagtatctgaagaccaagactatcactatc
gagtactga

DBGET integrated database retrieval system