KEGG   Nasonia vitripennis (jewel wasp): 100119037
Entry
100119037         CDS       T01081                                 

Gene name
Rpb7
Definition
(RefSeq) RNA polymerase II subunit 7
  KO
K03015  DNA-directed RNA polymerase II subunit RPB7
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
nvi03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:nvi00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    100119037 (Rpb7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:nvi03021]
    100119037 (Rpb7)
   03019 Messenger RNA biogenesis [BR:nvi03019]
    100119037 (Rpb7)
   03400 DNA repair and recombination proteins [BR:nvi03400]
    100119037 (Rpb7)
Transcription machinery [BR:nvi03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol II specific subunits
     100119037 (Rpb7)
Messenger RNA biogenesis [BR:nvi03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     100119037 (Rpb7)
DNA repair and recombination proteins [BR:nvi03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      100119037 (Rpb7)
SSDB
Motif
Pfam: S1 SHS2_Rpb7-N
Other DBs
NCBI-GeneID: 100119037
NCBI-ProteinID: NP_001137380
NASONIABASE: NV11361
Position
4
AA seq 173 aa
MFYHISLEHEILLHPRYFGPQLLDTVKQKLYTEVEGNCTGKYGFVVAVTTIDNIGAGIIQ
PGQGFVVYPVKYKAIVFRPFKGEVLDGIVTQVNKVGMFAEIGPLSCFISHHSIPADMQFC
PNVNPPCYKSKDEDVVIQADDEIRLKIVGTRVDATGIFAIGTLMDDYLGLVCN
NT seq 522 nt   +upstreamnt  +downstreamnt
atgttttatcacatatctctggaacacgagatccttctccatcccagatactttgggcca
caactgctggacacagttaaacaaaaattatacacggaggtagaaggaaattgtactgga
aagtatggatttgttgttgcggtcacaacaattgacaatatcggtgctgggattatccaa
ccaggacaagggtttgtcgtgtatcctgtcaaatataaggcaattgtcttccgacctttt
aaaggagaagtcttagatggtattgtcacacaagttaacaaggtgggcatgtttgcagag
attggacccttatcgtgctttatctcacaccattcgataccagctgatatgcagttttgc
ccaaatgtaaacccaccgtgctataaatccaaagatgaggatgttgtgattcaagctgat
gacgagataagattgaaaattgttggtacaagagtcgatgccactggaatttttgcaatc
ggaacattgatggatgattacttgggtcttgtttgtaattga

DBGET integrated database retrieval system