KEGG   Nasonia vitripennis (jewel wasp): 100119143
Entry
100119143         CDS       T01081                                 

Definition
(RefSeq) histone acetyltransferase KAT2A
  KO
K06062  histone acetyltransferase [EC:2.3.1.48]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
nvi04330  Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:nvi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    100119143
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:nvi03021]
    100119143
   03036 Chromosome and associated proteins [BR:nvi03036]
    100119143
Enzymes [BR:nvi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100119143
Transcription machinery [BR:nvi03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     100119143
Chromosome and associated proteins [BR:nvi03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    100119143
   HAT complexes
    PCAF complex
     100119143
    STAGA complex
     100119143
    TFTC complex
     100119143
    SAGA complex
     100119143
    SLIK complex
     100119143
    ADA-HAT complex
     100119143
    HAT-A2 complex
     100119143
SSDB
Motif
Pfam: PCAF_N Bromodomain Acetyltransf_1 Acetyltransf_10 Acetyltransf_7 Churchill
Other DBs
NCBI-GeneID: 100119143
NCBI-ProteinID: XP_008212302
NASONIABASE: NV17151
UniProt: K7J6Z6
Position
1
AA seq 816 aa
MSGEEGSRPISNVSAESVGQPVTSTSQGTSNNAEGKTTPRPEQDSRQNNLLRIQQRKQQM
FNLPQVKKLLKLANYSACQVDECKCNGWKNTQTVAKSPKNEAQPIATFSDPCRSCDHILE
NHISHLVSQSDEMINKLLGMVVDVDNIFMGMHREEDPDTKRVYYFLFKLLRKSILSMTKP
AIEGPLGQPPFEKPSISKAIANFVVYKFGHLSQRDWQSMYDLAKNFLHCLNHWNFETPSA
RKTAVNADEAPAYKINYTRWLVFCHVPAFCDSLPHFDTTLVFGRTLLQAVFKSVCKQLMD
KCHSEKDRMSAEKRVLVLNHFPKFLSMLEIEIYSENSPIWDPEFKQVLPSHLQMSVESKA
NLNRRTVGEFEKVTVAPNDKDNFTTINLSPGMKKLQGKRSHSEIRPDAKKRKTEEVFEDL
SEETVMKIIATIKDPNYMFGLDAIFPPNAPRDETPKLEESRKIIEFHIVGNSLTQPVSKQ
TMLWLIGLHNVFSHQLTRMPMEYISQLVFDPKHKTLALIKDGRPIGGICFRMFASQGFTE
IVFCAMTSEQQVKGYGTHLMNMLKDYHIKHNILHFLTFADEFAIGYFKKQGFSKDIKLPR
TTFQGYIKDYEGAMLMHCELNAKIVYTEFTTVVRKQKEIVKQLIYQRQQEIQKIHPGLTC
FKEGVRGIPVESIPGIRETGWKNYAQTRTRGVAKGSQGPEPMEACLDINDSLYNALKSVL
TSIKNHSAAWPFLKPVDKSEVPDYYDHIKYPMDLKTMTDRLKSRYYVTRRLFIADMTRIF
TNCRLYNGPDTEYYSCANSLEKYFQTKMKEIGLWDK
NT seq 2451 nt   +upstreamnt  +downstreamnt
atgtcgggggaagaaggcagcagacctatatccaacgtatctgcggagagtgtggggcaa
cctgtgacaagtacatcacaaggaacaagtaataatgcagaaggaaagactactccacga
ccggaacaggacagcagacaaaataacctgctcaggattcaacagcgcaagcagcaaatg
tttaacttgcctcaagtgaaaaaactgttaaaacttgcaaattacagtgcttgtcaagtc
gatgaatgcaagtgcaatggctggaaaaatacacagacagttgcaaagtctccaaagaat
gaggcacagccaattgcaacattcagtgatccttgtagaagctgtgatcacattttagaa
aatcacatttctcatctggtttcacaatcagatgaaatgataaacaagttattagggatg
gttgttgatgtagataacatattcatgggaatgcacagggaagaggatccagatacaaaa
agagtgtattattttttattcaaacttttaagaaagagtattttgtcgatgacaaagcca
gctatagaaggaccactaggtcagccaccatttgaaaagccaagtatatcaaaggcaatt
gcaaactttgtagtttataagtttggtcatttatcgcaacgtgattggcaatcaatgtac
gacttggcgaaaaattttttgcactgcttaaaccattggaattttgagactcctagtgcc
agaaagacagctgttaatgcagatgaagcgccagcttataagattaattacacaaggtgg
cttgtgttttgtcatgtacctgcattttgcgattcgcttcctcattttgacacaactcta
gtgtttggtagaactttactccaagcagttttcaaatcagtttgtaaacagttgatggac
aaatgccacagtgaaaaggataggatgtcagctgagaaacgagttctcgttttaaaccat
tttccaaaattcctttcaatgttagaaatcgaaatctattcggaaaactctccaatatgg
gatccagaatttaagcaggttcttccatcccacttgcaaatgtcagtagaatccaaagca
aatctgaatcgcagaacagttggagagtttgagaaagtgacagtagcacccaacgataag
gataactttacgacaattaacctcagtccaggcatgaagaagcttcaaggtaaaaggtca
cattcagaaatcaggccagacgcaaagaaaagaaagactgaggaagtttttgaggacttg
tcagaggaaaccgtaatgaagatcatagcaactattaaggatccgaactacatgtttgga
ctggacgctattttcccaccaaacgcacccagagatgagactccaaaattagaggagagc
cgtaaaatcatagagtttcacatagtcggtaatagtttgacacaacctgtctctaaacaa
actatgctgtggctcattggacttcacaacgtgtttagtcatcaactaacaagaatgcct
atggaatacatttcacaattagtttttgatccgaagcacaaaactctagcgctaataaaa
gacggcagacccatcggtggaatctgtttccgaatgttcgcaagccaagggttcaccgaa
attgtattttgcgccatgacgtccgaacagcaagttaaaggctacggcacccatctaatg
aacatgctcaaggattatcacatcaaacataatatacttcatttcctcacgtttgccgat
gaattcgctattggctattttaaaaagcagggattcagcaaagatatcaaattgccacgt
actactttccagggctacatcaaggattacgaaggggcaatgcttatgcactgtgagctc
aacgcaaaaatcgtctacaccgagttcacaactgtagtccgaaagcaaaaggagatcgta
aagcaacttatttaccagcgtcagcaggaaatacaaaagattcacccgggactgacttgc
ttcaaggagggtgtacgcggcatacccgtcgaatctataccaggtattcgagagactggg
tggaaaaattatgcgcagacgagaacaaggggtgtcgccaaaggttcacaaggtccagag
cctatggaggcttgtttggatataaatgactcactttacaatgcgcttaagagcgtttta
acgtccattaagaatcacagcgctgcttggccgttcttgaagcctgtcgataaaagcgaa
gtgcctgattattacgatcacatcaagtatcccatggatttgaagacgatgacagatcgg
ctgaagtcgaggtattatgttacacgacgcctctttattgctgacatgacgcgaattttt
acgaattgccgactgtacaatggccctgacacggaatactattcgtgcgccaactcttta
gagaagtatttccagaccaagatgaaggaaattgggctctgggacaaatag

DBGET integrated database retrieval system