KEGG   Nasonia vitripennis (jewel wasp): 100119152
Entry
100119152         CDS       T01081                                 
Name
(RefSeq) phosphoinositide 3-kinase regulatory subunit 4 isoform X2
  KO
K08333  phosphoinositide-3-kinase, regulatory subunit 4 [EC:2.7.11.1]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
nvi04136  Autophagy - other
nvi04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:nvi00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100119152
   04136 Autophagy - other
    100119152
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nvi01001]
    100119152
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:nvi04131]
    100119152
Enzymes [BR:nvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100119152
Protein kinases [BR:nvi01001]
 Serine/threonine kinases: Other
  VPS15 family
   100119152
Membrane trafficking [BR:nvi04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100119152
 Autophagy
  Autophagosome formation proteins
   PI3K complex
    100119152
SSDB
Motif
Pfam: Pkinase HEAT WD40 HEAT_2 PK_Tyr_Ser-Thr Adaptin_N TCAD9 NBCH_WD40 Vac14_Fab1_bd
Other DBs
NCBI-GeneID: 100119152
NCBI-ProteinID: XP_001602980
NASONIABASE: NV18273
UniProt: A0A7M7G4I4
Position
5
AA seq 1414 aa
MGNQLVGIAPSQIFPVEHYLTDHSDLRFDVSLGSTRFFKVARARSQEGLIVVKVFAIHDP
TLPLSTYKDKLEEIRSKLASAVNCLPFQRMILTEKAGFIMREYVKYSLYDRISTRPFLSS
IEKKWITFQVLYALHQAHKFGVCHGDIKLENIMITSWNWVLLTDFASFKPTYLPEDNPAD
FSYFFDTSRRRTCYIAPERFVKTLTSEPNNTLLFQELKTGDLHPMMDIFSAGCALTELYN
EGHPPFDFSQLLAYRNGDYSASKHLDNIEDEGIREILASMIEKNPSNRKSAELYLSQARG
KVFPEYFYGFLQSYMQIFSAAPILSPDEKISRLKKDIGNITSMFHEEIQERRQSVEMSKS
KCEKSTELSKQPSGHSEENTVIENDSDQSLEKIELDIKDAPKLDSLDSPADEEKEEVKES
KAAVENVDTEEGLVIITQLVTSCIRGLHHSQSKLQSLEILLELAENTSDETILDRILPYI
FHLVHDPAPRVRVSAIHTLTKCLYLVKTIPPSDVNIFPEYILPGLAHLTQDEAVIVRAAY
AENIAHLAHIALRYLENSHLSTVENKETQRPSYDSELQALHEMVQQSVSMLLTDQQNLVK
QTLMENGINKLCVFFGKQKANDVLLSHVITFLNDKEDKQLRGSFFECIVDVAAYVGWHCS
PILMPLLQQGLTDPEEFVTTKAISAMATLTELGLLHKSALYQLLSETVVFLVHPNLWIRH
ATVGFISAAARTLNIVDVQCKVQPMIQPYLKHPLIQIEKEVLLLEALVTPIPRVVLDSVI
KYNDIEELFHVFEQRQVARAKAVTGIVPQYNDMSTALRNLFRRLSSETMTETVEDQLLVM
KPHLLKINKYRQSAESKQQPSPVDGKLELGPLKHKISHHVVVLYPDTKSDIGLPSFKKLD
RRTSDSTATYASMNQEWRTMFAAHDNIQHSAVKISDMSTSGGSPSQSIHGGDIHLSPQHS
LSDTTNSINDHSLHERSYIQYRCAPCRLELRQLSYRKQEQHASAVRAQHWADNIAWQAGS
RLLPSGWRPRGVLIAYLHEHRAAVNRLVSVPDTSLFASSSADSCIKIWDASKMEGRNLAN
RSRQTYMHRGGPLVGLVVCEQGQSLASTASQSGTVFVLRIESNSSKMNVLYSRQLDMQEE
GCAVDLQYLDSGSQSVLVYATLYGSLIGWDLRCPGTAWRLENDLKHGVITSFCINNYQQW
LTLGTSSGVHICWDLRFQLPISNIKHPTGARVRKVITHPTEHSWIISAVQGNNEISMWNL
ETGFRQMVLWASSAPPLSHSQGGHSVCAMHSACIDRSGFLLASGSDMRLRFWNLHAPNES
YVVLPAANDSLTLNSLAYEQRLIDGTNVVQEVLAGGTSGPSSSGSSSMRSRGIEEGGPGP
EMPHPGHHDTISAVAMSNTCILTGSTDGLVQVWK
NT seq 4245 nt   +upstreamnt  +downstreamnt
atgggcaatcagctggtgggaatagcgccgagtcagatattccccgtcgagcattatctc
accgatcacagcgatctgagattcgatgttagcctgggaagcacaagatttttcaaggta
gccagagctcgcagtcaagaaggtctaattgtagtaaaggtcttcgcgatccatgatccc
accctgcctttgtcaacgtataaggataaattggaagaaataagatccaagttagcctct
gcagttaactgtttaccgttccagcggatgatactgacagagaaagcaggttttattatg
agagagtatgtcaagtactcgttgtatgatcgtataagtacgaggccatttttgtcgagc
atagaaaagaaatggatcacatttcaagtattgtacgccttgcaccaagcgcacaagttt
ggtgtctgtcatggggatattaaactcgaaaacataatgataaccagctggaactgggtt
ttactaacagactttgcaagctttaagccaacttatctgccagaggataatcctgcagat
ttttcatacttttttgatacatctagaagaagaacatgctacattgcaccagagagattt
gttaaaacgttgacttcagaacccaacaataccctgctctttcaagaacttaaaacagga
gatttgcatcccatgatggatattttttcggccggttgtgctttgactgaattgtacaat
gaaggccacccgcctttcgatttctctcaacttttagcttatagaaacggcgactactct
gcaagcaagcaccttgataatatagaagacgaaggcattcgagaaatcttggcctcgatg
atcgagaaaaatccgtcgaatcgcaagagcgctgaattgtatttgtcacaggcacgaggc
aaagtgtttccagaatatttttatggatttctacagtcgtacatgcagatcttctcggca
gcgccgatcctctcacccgatgaaaagatcagtagactgaaaaaagacatcggtaatatt
accagcatgtttcacgaggaaatccaggagagacggcagagcgtcgaaatgtcaaagtcg
aaatgcgaaaagagcacagagttgtcgaaacaaccgtctggtcacagtgaagaaaatacg
gtgatcgagaatgacagcgatcaaagcttggaaaagatcgagctagacattaaagatgct
ccaaaattggactcattagattctccagctgatgaagaaaaagaagaagtaaaggaaagc
aaagcagctgtggaaaatgtggacaccgaggagggacttgtcattatcacgcagcttgtt
acgtcgtgtattcgaggactgcatcattcgcaatctaaactgcaaagcttagaaattctg
ctcgagttggccgaaaatacgtcggacgaaactattctagataggattttaccatatatt
tttcatttggttcacgatcctgcgccaagagtgcgagtgtcagccatacacactttaaca
aagtgtctttatctcgtaaagacgatcccgccctcggatgtcaacattttcccggaatac
atactgccagggctagcccacctcacacaagacgaggcggtgatcgttagagctgcctac
gctgagaatatcgctcacttagctcacattgcacttcgatacctagaaaactctcatttg
tcgacggtagaaaataaagagacgcagaggccgagttatgacagcgaacttcaggctttg
catgaaatggttcagcaatcagtttcaatgttgctcacggatcaacaaaatttagtcaaa
caaactctaatggagaacggtatcaataagctttgcgtatttttcggcaaacagaaagct
aacgatgttttactcagtcacgtaatcacgtttttaaatgacaaagaggacaagcaactg
cgaggttccttttttgaatgcatcgttgatgtggctgcgtacgtaggctggcattgtagt
cctatactgatgcctctacttcaacagggactgacagacccagaagagtttgtgactaca
aaagctattagcgcgatggcaactttgacggaacttggcctcttacataaatctgctttg
tatcaattgctttctgagactgttgtatttttagttcatcctaatttatggataaggcac
gcaactgtaggattcatatcagcagccgcgcgaactctcaacatagtcgacgtgcagtgt
aaggttcaaccaatgatacagccatacttgaagcatccgcttatacagatagaaaaggaa
gtcttattgttagaagcattagttacaccgatacctcgtgttgttctcgattctgtgata
aaatataacgacatcgaagaacttttccacgttttcgagcagagacaagttgctagggcc
aaggctgttacgggaattgttccccagtacaacgatatgagcacagctttgcgtaatctc
tttagacgcctaagttcagaaacaatgactgaaaccgtagaagatcagctgctcgtaatg
aagccacacttattgaaaatcaacaagtatcggcagtcggctgagtcgaagcaacagccg
tctccggtcgacggtaaactcgaactcggaccattgaagcataaaattagtcaccacgta
gtcgttctctatcccgataccaagagcgacatagggcttccatcgttcaaaaagttggac
cgcagaacgtccgacagcactgctacctacgcctcgatgaatcaagagtggcgcactatg
tttgcggctcatgataatattcaacattcggcagtaaaaatttccgacatgtcaacaagc
ggaggcagtcctagtcagagtattcacggaggcgatattcatttatctccgcagcatagt
ttgtctgacactacgaacagtatcaatgatcactctcttcacgaaaggtcctacatccag
tatagatgcgcgccttgtcggttagaactcaggcagctcagttacagaaagcaggagcaa
catgcatcagccgttagggctcaacactgggctgataatattgcgtggcaagctggttca
agactactgcctagtggttggagacctcgtggagttcttatagcttatcttcacgagcac
agagctgccgttaatagattggtttcggtgccagacactagtctatttgctagcagttct
gctgacagttgcataaaaatttgggatgctagtaaaatggaaggaagaaacttagctaat
cgatcaagacaaacatacatgcatagaggaggaccgttagtgggtctggttgtttgtgaa
cagggccaatcactggcaagtacagctagccagtctggaacggtgttcgtattgagaatt
gaatccaactctagtaagatgaacgtactgtattcgagacagttggacatgcaagaagag
ggctgtgcagtagatctgcaatatctggactcaggatcgcaatccgttctcgtctacgca
acactttacggttccttgatcggttgggatctcaggtgtcctggaaccgcttggagactc
gaaaatgacttgaagcatggtgttattacgtctttttgtatcaacaattatcagcaatgg
ctcactcttggtactagttctggagtgcatatatgctgggatttgagatttcagctgccg
atcagtaatattaaacatccaacaggagcacgagtcagaaaagtaataacccacccaacg
gaacattcttggataatatcagcggttcagggcaacaatgaaatatctatgtggaatttg
gagacgggctttcggcagatggtgctttgggcctcgagtgcacctcctctcagtcattca
cagggcgggcatagtgtctgtgcaatgcattctgcttgtatagatcgttcgggcttctta
cttgcaagtggttccgacatgagactaagattttggaatctgcatgcacctaacgagtcc
tacgtcgtcctgccggctgctaatgattcgttaacactcaattcgttggcttacgagcaa
cggctgatagatggtacaaatgtagtgcaggaggtgctagccggtggaacgagcggtcca
agttcgtcaggcagctcgagcatgcgaagtcgaggtattgaggaaggtggcccgggtccc
gaaatgccgcacccaggtcatcacgatactatctccgcagtggccatgtccaatacttgc
atactcacaggcagcaccgatggcctcgttcaagtttggaagtga

DBGET integrated database retrieval system