KEGG   Nasonia vitripennis (jewel wasp): 100119157Help
Entry
100119157         CDS       T01081                                 

Definition
(RefSeq) beta-galactosidase-like
  KO
K12309  beta-galactosidase [EC:3.2.1.23]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
nvi00052  Galactose metabolism
nvi00511  Other glycan degradation
nvi00531  Glycosaminoglycan degradation
nvi00600  Sphingolipid metabolism
nvi00604  Glycosphingolipid biosynthesis - ganglio series
nvi01100  Metabolic pathways
nvi04142  Lysosome
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    100119157
  Lipid metabolism
   00600 Sphingolipid metabolism
    100119157
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    100119157
   00604 Glycosphingolipid biosynthesis - ganglio series
    100119157
   00511 Other glycan degradation
    100119157
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    100119157
Enzymes [BR:nvi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     100119157
Exosome [BR:nvi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100119157
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_35 Glyco_hydro_42 BetaGal_dom4_5
Motif
Other DBs
NCBI-GeneID: 100119157
NCBI-ProteinID: XP_001602984
NASONIABASE: NV18425
Position
4
AA seq 638 aa AA seqDB search
MSYLGCLITTLVISCAVSATKDQVTNRTSFAIDFENNQFLLDGKPFRYVSGSFHYFRTPK
QYWRDRLRKMRAAGLNALSTYVEWSLHQPEPNKWVWDGDADLVKFLQLAQEEDLFVLLRP
GPYICAEREFGGFPYWLLNLVPGIKLRTNDTRYLEYAEEYLNQVLTRVKPLLRGNGGPII
MVQVENEYGSFHACDKDYMTKLKNIIQNHVGTDALLYTTDGSYRQALRCGPVSGAYATID
FGTSSNVTQNFNLMREFEPKGPLVNSEFYPGWLSHWEEPFERVETFKITKMLDEMLSLGA
SVNMYMFYGGTNFAFSSGANIFDNYTPDLTSYDYDAPLSEAGDLTAKYHEIKKIISKYLP
IPDIPIPVASKGNYGTVTMRPVLNLFDLQARTLFGTVRVQAKEPPTFEALNLPNWLVLYE
ANLPTTETNEDQATLSAVPKDRVLIYLDGRFSGTLSRTHNAMNVALKVDDAKEVKLLVEN
QGRVNFGDIDVEDFKGIFNVMLNNANITPWNVTGFRFDTILESTLNVIQSSLEETQTLFT
GPQILIGHFKITGEPQDTFLNTADWGKGVAFINNHNLGRYWPLIGPQLTLYVPAPYLKKG
QNTLVLVELEYVPRNRQIQFQSFPILDYPSNVTKIDDF
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atgagttatttaggatgtttaataaccacgttagtaatatcatgtgcggtcagtgcaaca
aaagatcaagttacaaatcgtacaagtttcgcaatagattttgaaaataatcaattttta
ctggatggtaaaccatttagatacgttagcggtagttttcattactttcgaacacctaaa
caatactggagagataggttaagaaaaatgcgagccgctggattaaatgctctttctaca
tacgttgagtggagtctacatcagccagaaccaaacaaatgggtgtgggatggagatgca
gatcttgtcaaatttttacaattggcacaagaagaagatttatttgttttattgagacca
ggaccatacatttgtgctgaaagagaatttggtggttttccatattggcttttgaattta
gttcctggcattaaattacgaactaatgatactaggtatctcgaatatgctgaggagtat
ctgaaccaagtattaacgagagttaaaccattgctgagagggaatggtggaccaattatt
atggttcaggtagaaaacgaatatggaagttttcatgcatgcgataaagattatatgact
aaattgaaaaatattattcaaaaccacgttggcactgatgctcttctatacactactgat
ggctcatatagacaagcacttcgttgtggaccagtatcaggggcatatgcaacaattgat
tttggtacttcaagtaatgtaacacaaaattttaatcttatgcgtgaattcgaaccaaag
ggcccgttggtgaattctgaattctatcctggttggttatcgcattgggaagaaccattt
gaaagagttgaaacgtttaaaataactaaaatgcttgatgagatgctatctcttggagcc
tcagttaatatgtacatgttttacggtggtactaactttgccttcagttcaggcgctaac
atatttgacaactacactccagatttaacatcatacgactatgatgcaccccttagcgaa
gctggagacctgactgcaaaatatcatgaaattaaaaaaatcatttccaagtatcttcca
ataccggatattccgataccagtagcttcaaaaggtaattatggcacagtaacaatgagg
cctgttttaaatctattcgatcttcaagctcgaacattgtttggcactgtgcgggtacaa
gcaaaagagccgccaacttttgaagctttaaatctaccaaactggctggttttatacgag
gccaatctacccacaactgaaacaaacgaagatcaggctactctatctgcagtaccaaaa
gacagagttttaatttacttagatggaaggttttcaggaactttgagcagaacacacaat
gctatgaacgttgctttaaaagtagatgacgccaaagaagttaaattgctcgtagaaaat
caaggtcgtgttaactttggagatattgatgttgaagattttaaggggatattcaacgta
atgctaaataacgccaatattacgccgtggaatgtgactggtttccgatttgatacaatc
ttggaatccacattaaatgttatccaatcgtcgttggaagaaacacaaacgttgtttact
ggtccgcagattcttattggtcattttaagattacaggggagccccaagacacgttttta
aatacagcagattggggaaaaggagtcgcttttattaataatcacaatctcggtagatac
tggccattgatagggcctcagctaaccttatacgtcccagctccatacttgaagaaagga
caaaatacattagtcttggttgaattggaatatgtacctagaaaccgacagatacaattt
cagtcttttccaattttagattatccatcaaatgtgactaagatagatgatttttaa

DBGET integrated database retrieval system