KEGG   Nasonia vitripennis (jewel wasp): 100119177
Entry
100119177         CDS       T01081                                 

Definition
(RefSeq) general transcription factor IIF subunit 2
  KO
K03139  transcription initiation factor TFIIF subunit beta [EC:3.6.4.12]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
nvi03022  Basal transcription factors
Brite
KEGG Orthology (KO) [BR:nvi00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    100119177
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:nvi03021]
    100119177
Enzymes [BR:nvi01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     100119177
Transcription machinery [BR:nvi03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIF
     100119177
SSDB
Motif
Pfam: TFIIF_beta TFIIF_beta_N
Other DBs
NCBI-GeneID: 100119177
NCBI-ProteinID: XP_031784879
NASONIABASE: NV16996
Position
4
AA seq 270 aa
MSSSSAAHAEKDLDLSNAGRGVWLVKVPKYIASKWEKAPGNIEVAKLRITKHVKQKAEVT
LKLSEAVLALKEPGEQDIPKQHKLDVTTVIHQTLGVFSHLPSPNNADTSAPEADKLSMEG
KIVQKLECRPHADNTYMKLKLESIKKASIPQRQVQQLQRAVQNFKPVSDHKHNIEYAEKK
KAEGKKMRDDKAVVLEMLFAAFEKHQYYNIKDLVKITRQPVVYLKEILNEVCNYNLKNPH
RNMWELKPEYRHYKDEKPANAESSKDNDSD
NT seq 813 nt   +upstreamnt  +downstreamnt
atgtcgtcctcgtcagcagctcatgcagagaaagatcttgatttgtcaaatgcaggtcga
ggcgtttggctcgtcaaagtaccaaaatacatagccagcaaatgggaaaaagctcccggc
aatatcgaagtcgcaaaacttaggataacgaaacatgtcaagcaaaaagcagaagtgacg
ttaaagctctcagaagctgttttagcactcaaggaacctggggaacaagatattccaaag
caacataaattagacgttacaacagttattcaccaaacgctaggagttttttctcattta
ccatcaccaaataatgcagatacttcagcaccagaagcagacaaattgagtatggaaggg
aagatcgtgcaaaaattagaatgtagacctcacgctgacaacacctacatgaaattaaaa
cttgaaagtatcaaaaaagcttcgatcccccaaagacaagtacagcaattacagagagca
gttcaaaactttaaacctgtctctgatcataagcacaatattgaatatgctgagaaaaag
aaagcagaaggcaagaaaatgcgagatgataaagctgttgttctggaaatgttatttgca
gcatttgaaaagcatcagtactacaacattaaagatcttgtaaaaataacaaggcaacct
gtggtgtatctgaaagaaattttgaatgaagtttgcaattataacttaaaaaatcctcac
agaaatatgtgggaattgaaaccagaatatagacattataaggatgaaaaacctgcaaat
gctgaaagttcgaaagataatgattctgattag

DBGET integrated database retrieval system