KEGG   Nasonia vitripennis (jewel wasp): 100119262
Entry
100119262         CDS       T01081                                 

Symbol
Rpl6
Name
(RefSeq) ribosomal protein L6
  KO
K02934  large subunit ribosomal protein L6e
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
nvi03010  Ribosome
Brite
KEGG Orthology (KO) [BR:nvi00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    100119262 (Rpl6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:nvi03011]
    100119262 (Rpl6)
Ribosome [BR:nvi03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    100119262 (Rpl6)
SSDB
Motif
Pfam: Ribosomal_L6e Ribosomal_L6e_N BRF1
Other DBs
NCBI-GeneID: 100119262
NCBI-ProteinID: NP_001153391
NASONIABASE: NV12167
UniProt: A0A7M7QWL5
Position
5
AA seq 273 aa
MADTKAKTAAPKAAAPKDAASAKKGEKKRVSRPRNYDLGNGVYRFSRSRMYHKKAIYKFI
GKKTPKKEVPKKLVSIEKKINGEKNGGTRTVLLKKRKANYPTSDPIVPHPTKRCFKDHTR
YIRPSLKPGTVLILLAGPHKGKRVVLLKALKSGLLLVTGPFLINACPMRRINQIYVIATS
TRINLSGFKLPKHINDDYFKRKHEKRAKKEEGDIFAKKKEEYKPSEQRKVDQKVIDKAVI
DAIKKSADKKVLFAYLASMFGLRSSQYPHRMKF
NT seq 822 nt   +upstreamnt  +downstreamnt
atggcggataccaaggcgaaaaccgctgcgcccaaggcagcagctcctaaggatgctgct
tccgccaaaaagggcgaaaagaagagggtcagcagaccaaggaactacgacttgggaaat
ggagtttacaggtttagccgtagtcgtatgtaccacaaaaaggccatctacaagttcatt
ggcaagaagacacccaagaaggaagtacccaagaaacttgtaagcatcgaaaagaagatt
aatggtgagaagaatggaggaactaggactgttctccttaagaagaggaaggcaaattat
cctacctcagatcccattgtccctcaccccaccaagaggtgcttcaaggatcacacccgg
tacatcagaccatcgctgaaaccaggaaccgtccttattctgttggctggacctcacaag
ggaaagcgtgttgtcctcctcaaagccctgaagagtggtttactccttgtcactgggcct
ttcctcatcaatgcatgcccaatgaggagaatcaaccaaatttacgtcatcgctaccagc
acaaggattaacttgtctggtttcaagcttccaaaacacatcaatgacgattacttcaag
aggaaacacgagaagcgtgcaaagaaagaggaaggtgacatctttgccaagaagaaggag
gagtacaaacccagcgaacagaggaaagtggaccagaaagttatcgacaaggctgtcatt
gatgctatcaagaagagcgctgacaagaaagtgctctttgcctaccttgcatcgatgttt
ggactgcgtagcagtcagtacccacacaggatgaagttctaa

DBGET integrated database retrieval system