KEGG   Nasonia vitripennis (jewel wasp): 100119339
Entry
100119339         CDS       T01081                                 
Name
(RefSeq) 5'-3' exoribonuclease 1 isoform X2
  KO
K12618  5'-3' exoribonuclease 1 [EC:3.1.13.-]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
nvi03008  Ribosome biogenesis in eukaryotes
nvi03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:nvi00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    100119339
  09123 Folding, sorting and degradation
   03018 RNA degradation
    100119339
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:nvi03019]
    100119339
   03009 Ribosome biogenesis [BR:nvi03009]
    100119339
   03016 Transfer RNA biogenesis [BR:nvi03016]
    100119339
   03036 Chromosome and associated proteins [BR:nvi03036]
    100119339
Enzymes [BR:nvi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.-
     100119339
Messenger RNA biogenesis [BR:nvi03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     100119339
  mRNA degradation factors
   5'-3' decay
    5' exonucleases
     100119339
Ribosome biogenesis [BR:nvi03009]
 Eukaryotic type
  Pre-60S particles
   RNases
    100119339
Transfer RNA biogenesis [BR:nvi03016]
 Eukaryotic type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    100119339
Chromosome and associated proteins [BR:nvi03036]
 Eukaryotic type
  Gene silencing
   piRNA pathway
    100119339
SSDB
Motif
Pfam: XRN_M XRN_N XRN1_D1 SH3_12 XRN1_D2_D3 Dicer_dimer
Other DBs
NCBI-GeneID: 100119339
NCBI-ProteinID: XP_001603129
NASONIABASE: NV10050
UniProt: A0A7M7G3U7
Position
1
AA seq 1739 aa
MGVPKFFRYISERYPCLSEKLKEYQIPEFDNLYLDMNGIIHNCSHPNDADATFRITEETI
FKNIFHYIEILFRIIQPQKLFFMAVDGVAPRAKINQQRGRRFRAAKEAEVLEAKARAKGQ
EIPKEARFDSNCITPGTVFMSKLNEQLKYFITYKISTDKLWQKCKIILSGSEVPGEGEHK
IMDYIRYMKAQPDYEGNTRHCLYGLDADLIMLGLCSHEPHFSLLREEVKFGKTQKKILTP
EETNFCLLHLSLMREYLEHEFSPVKDKLTFKFDIEKIIDDWVLMGFLVGNDFIPHLPNLH
IENGALPLLYNAYMDVLPTLDGYINEAGTLNLERFEKFMEKLGKYDLEQFDEIYADLKFF
EAKTGRRLNESERNSKNSPDENASPKKTNKALNALIMATENELGADSDEDLEGESDSDTE
MQLEFVQHKRDYYMNKMEYANVDAETMRSQAEGYIRAIQWNLHYYYNGCCSWSWYYPHHY
APFISDIKNFKDLKLEFDLGEPFKPFEQLLAVLPAASKSLLPTAYHGLMTEEKSPIIKYY
PLDFKTDLNGKKQEWEAVVLIPLIDEKSLLKAMKPCNAKLTPEERKRNSHGPMSIFTFIE
KEQGIYEAPEYFPSIRSYAQMMLVNRDDILVPLERLVKGLCKGVQLSVYYPGFPTLQHIP
HTACLAKAKVKVFEQPSRRENMILTVLPKELPPIDDLARKWLGKTVFIAWPHLVEALVVE
VANSKTKISITYPQPKHATDGNHNFNTESMNDMLLSTFNVQRKSITENYKTRLGIDVGNI
EILIHAAPIMGRQYVYSAQGKMTLEKQWSDVPQAYAYQVVLKDISIHNHDFIQFTSITDV
FKPKSVCFMLGHPHYGAMGEVTEGGVDLKSSRVKVAMRVTSEPNFDRVRQLQADTRMRYM
PGNIAAQRLGISSHLLSRITGTVFVINGEGVDPAHASKYNLGLNLKFNKKNEEVPGYTKK
DINGTWLYSVKAVDFVKSYIQKFPELFERLEMNLVSSDMFLREHLFPNTGAEGVDATVSW
LKEQQKARGTTTRTCGTEELETEVVQAIEKDVDASLEAQRQAGKSVLMQVKPHLLYKPGL
NSGSVPPDPKAQHRFFDRIVCVRDSFTVPLGYKGTIIGVQKNENPLLTMYEVLFDIAFAG
GLVMHGCSSNRSYRLAATDFINISYGLQIENKNSKVNIATSNWRQQQSQQNASSRGPDSW
RQSQPQQHQSPHPPDPTILNSFYPAFTKNGQSNNKRQQGSQQQKQQGQGRHQSGNKAGFN
DSPSHGRKQNLDQQSQFPQPPILLQRSQEPGKKTLPPIQNIQPQQHQHPKGQGPSEFQAL
WNELHKIQKPMDSPKRQAPAPAPEKEKPSPAMNAVTESPQDPSAFLKAMLKISDENTQCQ
IPSSSTAAPPANKPLAFPQMPKTTETPALVQQLFDHARQTEMKSGKSIWYCAQLLSYFQL
LGTGFPRYAYHKNKDNLVCAQVTLPDMRVFCGEFCRTESEAAENTAKKVYEELKLSKMPP
AVSNARPNPLRPPPQQWFDNRMNNVRPPMPPQPNVKPMLPAAFPQVPMMQLPMPKWNPMV
QQNPGFANMMHPGQPHPIQQQQLQQPPQHNRPQQQQHHQQGRFPQPQLVDNAHSRSNRQD
QQKKVTPFVPLQAQKKTRNVVNKQPSNEDNKQQKQQQQQHDKKEKKEVYENKVDQKPKEN
SAEDVKQENVCSNNKTSENTVQNNQGQNAQKGQRSVKQRRSRVAAKFQSDPMANGGDRQ
NT seq 5220 nt   +upstreamnt  +downstreamnt
atgggagtaccaaagttttttagatacattagcgaaaggtacccatgcctcagcgagaaa
ctcaaagaatatcagattcctgagtttgataacttgtatttggatatgaatggcattata
cataactgctctcatcccaacgatgcagatgctacgtttcgtatcacagaggaaactata
tttaaaaacatatttcattatatagaaatattgttccgcattatacagccccagaagctg
ttttttatggctgtggatggtgtggcaccacgtgccaaaattaatcaacagaggggacgc
cgtttcagagctgcaaaagaggctgaagtactagaggcaaaagcacgagctaagggtcaa
gaaattcctaaggaagcaagatttgactctaattgcattacaccaggaacagtatttatg
tcaaaacttaatgaacaattaaagtattttattacatataaaatatccactgataagttg
tggcaaaagtgtaaaattattcttagtggatctgaggtacctggtgagggtgaacacaaa
ataatggattacattaggtatatgaaagcccagccagactatgaaggaaatactcgccat
tgtttgtatggtttagatgcagatctcataatgctgggtttgtgttcacatgaacctcat
ttttccttacttcgtgaagaagtcaagtttggtaaaactcaaaagaaaattttgactcct
gaggagacaaatttttgtcttttacatctgtctctgatgagagaatatctggagcatgag
ttttctcctgttaaagacaaattaactttcaagtttgatattgaaaaaataatcgacgac
tgggttttaatgggttttctagtaggaaacgattttatcccacatttaccaaatttacac
attgaaaatggtgcactgccacttttatataatgcttatatggacgtattaccgacctta
gatggatacattaacgaagctggtactttgaatctcgaacgctttgagaaatttatggaa
aaattgggtaaatatgacttggaacagtttgatgaaatctacgccgaccttaaatttttt
gaagcaaaaacaggtcgacgactaaatgagagtgaaagaaatagtaaaaattctccagat
gaaaatgcatctccaaagaaaactaataaagctttgaatgctttaataatggcaacggaa
aacgagttgggagcagattctgatgaagatctcgaaggtgagagtgattcggatactgaa
atgcagcttgaatttgtacaacataagcgtgattattacatgaataaaatggaatatgca
aatgttgatgcggaaacaatgcgttcacaagcagaaggttatattagagccatacaatgg
aacctgcactattattacaatggatgttgtagttggtcttggtactatccacaccattac
gcgcccttcatctcagacataaaaaatttcaaagacttaaaactagaatttgacttggga
gaacctttcaaaccatttgaacaattgttagcagttcttccagcagccagtaaaagcttg
ttacctacagcttatcatggacttatgactgaagaaaaatccccaattattaagtattat
cccttagattttaaaacagacttaaatggaaagaagcaagagtgggaggcagttgttttg
attcctttaatcgacgaaaaaagtcttttaaaagctatgaagccatgtaatgcaaagtta
acacctgaggaaagaaaacggaattctcatggaccaatgtcaatatttactttcattgaa
aaagagcaaggaatttacgaggctcccgaatacttccccagtatacgaagttatgcacaa
atgatgctagtgaatcgagacgatattttagtgccgctagagagactagtaaaaggttta
tgcaaaggagtccaactaagcgtttactatcctggattccccacattacaacacattcca
cacacagcatgtttggcaaaagccaaggtaaaagtgtttgaacagccttcaaggcgcgag
aacatgattctcactgtactgccaaaagaactgccgccaattgacgatttagctcgaaag
tggcttggcaaaacagtttttatcgcttggccgcatttggtcgaagcattagtcgtagaa
gtagctaattcaaagaccaaaatcagcatcacgtatcctcaaccgaaacatgcaactgat
ggaaaccataatttcaacacagaatcaatgaacgacatgcttctatcgacattcaacgta
caaagaaaatcgataacagaaaactacaaaacccggctaggtattgatgtgggcaatatt
gaaatactaattcacgctgccccgatcatggggaggcaatatgtgtacagtgcacaaggc
aaaatgacactcgaaaaacaatggagtgacgtaccgcaagcatatgcgtatcaggtcgtt
cttaaagacatttcgatacataaccacgattttattcaatttacatcgataaccgatgta
ttcaaaccgaaatccgtctgcttcatgctgggccacccgcattatggtgcgatgggtgag
gtcacagaaggtggagtagatttaaaatcaagcagagtcaaagtggcaatgagagtaaca
tcagaacccaactttgatagagttagacagttacaagcagatacaagaatgagatacatg
cctggcaatatagctgcccagcgtctaggtataagcagtcatcttcttagtcggataaca
ggaactgtttttgtgataaatggagaaggagttgatcccgcgcatgctagcaagtataac
ttgggattgaatttaaagttcaacaaaaagaacgaggaagtacctggatacacgaaaaag
gacatcaatggaacgtggctatacagcgttaaagctgttgattttgtaaaaagttatata
caaaagtttcccgaactatttgagcgtttggagatgaatctcgtatcgtccgatatgttc
ctgagggaacatcttttcccaaatacaggagctgaaggtgttgacgcaacggtttcctgg
ctaaaagaacagcaaaaagcccgtggcacaacgactcgtacttgcggtactgaagaacta
gagaccgaagttgttcaggccatcgaaaaagacgttgatgcaagtcttgaggcccagcgt
caggctggcaaaagcgttcttatgcaggttaagccgcatttgctctacaagccaggtctg
aattcgggaagcgtgccacccgatcccaaggcacaacatcggttctttgaccgcattgtc
tgtgtcagggatagttttacggtaccgctaggatataagggtactataatcggagtgcag
aaaaatgaaaatccgttactcaccatgtacgaagttctctttgacatagcttttgcgggt
ggtcttgtaatgcatggttgttcttcaaaccgaagctacagactggcagctacggacttc
atcaacataagctacggactacaaatcgagaacaaaaactcaaaggtcaacatagccacg
tcgaattggcgtcaacagcagtcgcagcaaaatgcttcttctcgtggtccagattcttgg
cgtcagagccaacctcagcagcatcagtcacctcacccgcctgaccctaccatcctcaac
agtttctacccggcatttacaaaaaatggtcagagcaataacaaacgacagcaaggttct
cagcagcagaaacaacagggtcaaggaaggcatcaaagtggtaacaaggccggtttcaac
gactcgccgagtcacggtagaaagcagaatttggatcagcaatcgcagttcccgcagcca
ccgattttgctacagcgttcccaagaaccaggaaagaagacgctaccaccaatacagaat
attcagccacaacagcatcagcatcctaaaggccaaggaccttccgagtttcaggcttta
tggaatgaattgcataagatacagaaacctatggattcaccgaaaagacaagcaccggcc
ccagctccagagaaagagaagccaagcccagcgatgaatgccgttacagaatcgcctcaa
gacccgagtgcttttttgaaagcaatgttgaaaatttccgacgaaaacacgcaatgccag
ataccgtcctcctcaactgcggcgccgccggcaaacaaacctttagcatttccgcaaatg
ccaaaaacgaccgagactccggctttggtgcagcaattgttcgatcacgcgcgacagacg
gagatgaaaagcggcaagagtatctggtactgcgcgcaactgctgtcgtacttccagttg
cttggtaccggctttcctcgatatgcataccacaagaacaaagataatctggtatgtgcc
caagtgacgctgccagacatgagggttttctgcggtgaattctgtcgcacggaatctgaa
gctgctgagaacactgccaagaaggtttatgaggaactaaaacttagcaaaatgccacct
gcagtcagcaacgctcggccgaatcccttgcgtcctccaccgcagcaatggtttgacaac
cgcatgaacaatgtgcgaccaccaatgcctccacagccaaatgttaaaccgatgctacca
gcagctttccctcaggtaccgatgatgcagcttccgatgcctaagtggaacccgatggtt
cagcagaatcctggcttcgcgaacatgatgcatcctggtcaacctcatcctattcagcaa
caacagcttcaacaaccaccacaacacaataggccgcagcaacagcaacatcatcagcag
ggcagatttccacaaccacagcttgttgataatgcccatagccggtcaaacagacaggat
cagcaaaagaaagtgactccattcgtgccgttgcaagcacagaagaagacgagaaatgtg
gtcaataaacagccgagcaatgaagataataaacagcaaaaacagcaacagcagcagcac
gataagaaagaaaagaaggaagtctacgaaaataaggtggatcagaagcctaaagaaaat
agtgcggaggatgttaagcaggaaaatgtttgcagtaataataaaacttcggaaaatact
gtacaaaacaatcaagggcaaaatgcacaaaagggacagagatccgtaaaacagagacga
tcgagagtcgccgccaaatttcagtcagatccaatggctaatggcggcgaccgacagtga

DBGET integrated database retrieval system