KEGG   Nasonia vitripennis (jewel wasp): 100119443
Entry
100119443         CDS       T01081                                 
Name
(RefSeq) neither inactivation nor afterpotential protein C isoform X1
  KO
K08834  myosin III [EC:2.7.11.1]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
nvi04745  Phototransduction - fly
Brite
KEGG Orthology (KO) [BR:nvi00001]
 09150 Organismal Systems
  09157 Sensory system
   04745 Phototransduction - fly
    100119443
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nvi01001]
    100119443
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:nvi03037]
    100119443
   04812 Cytoskeleton proteins [BR:nvi04812]
    100119443
Enzymes [BR:nvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100119443
Protein kinases [BR:nvi01001]
 Serine/threonine kinases: STE group
  STE20 family
   100119443
Cilium and associated proteins [BR:nvi03037]
 Other cilia and associated proteins
  Stereociliary proteins
   100119443
Cytoskeleton proteins [BR:nvi04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     100119443
SSDB
Motif
Pfam: Myosin_head Pkinase PK_Tyr_Ser-Thr ABC1 Pkinase_fungal IQ Kdo Kinase-like APH Seadorna_VP7
Other DBs
NCBI-GeneID: 100119443
NCBI-ProteinID: XP_008202414
NASONIABASE: NV18280
UniProt: A0A7M7LTR7
Position
5
AA seq 1642 aa
MSEYGRRGGGGARHGRDEEEEEEDDCEYEARERSRGRGRSGGGGDRGGGGGGGGGGSGPE
KLQRLDSIQDPGKRYALRDRIGSGVCGDVYEAIDEEGSRKVAIKIQKLTPETQPLIVEEY
RVLRDFSSHPNLPDFYGVYRRRSGKKTEYDQIWFVMELCDGGPVIDLVRGLKMTDKRMRE
EHIAYILRETIKAVVHLHENNVLHRDVRASNIMLTREGEVKLVDFGLARMIKGEMGKRYT
CIGSPNWMAPEVVMSKSEQSHGYGSRADVWAIGITAIELGDGHPPFQDMHPTRALFQIVR
NPPPTLYRPANWTQNFNDFIAECLEKNPDNRPFVAEIVEHPFLSELPENDYPLTQEIKAL
AANLSGKGKRDRKPESIVRKGYLKTHQTQLPERMHQEDLAALEQLTEDRVLDELQERLRQ
GSFHTFVGDVLLILNPNEEQDIYGPIYHTKYQNKSRSDNSPHIYSVADSAYQDVLHHEEP
QHVLFAGESNSGKTTNMMHLVRHLMYLGKSLKDTGARVIKAISLIHSFTNAATPLNTNST
RCVFQIQTTYGSTGKASGAIFWVYQLEKFRVSTRDRNQSNFHVFYYFYDGLEASGNLRQY
LLPQGRRMRYLRVYEQDSVSGRKRSFKVRNDPHGNARKFEHIKECLKALELEEHCETIWR
TLAAVLNLGDVRFIEGNGGEAEVHNIETARSVAELLQLDVKKFTWSLCNYCVVKKGAAVR
RRHTCDEAKEARDVLANTIYQRLVDWIVNNINEKLSVSRTLFGDKFLISILDLFGFECFS
KNRLEQLLVNTMNEQLQCHYNQRVFVWEMQEQEEEEIPIERFHFYDNKQAIDQLMGKTDG
LFYVLDEASRQLQDTNYIFERIQGRRSASSTQHVKVQAGQEFSVAHYTGKLSYDASEIAE
KNRDFVPPEMIETLRQSSHAVVKELFTNKLSKAGALTIVSQEKPKDKEKPKKTTARSKWG
AALLHSDQTTNLRKYNTASRGQYSQTRKMRTYAATFRASSLEILKNLSVGAVSGGTHFVR
CIRSDLEGQPRGFYREVVRQQIRALAVLDTAKARQRGYPFRITFQEFLRRYKFLAFDFDE
NVEMSQDNCRLLLVRLKMEGWIIGKSKVFLRYYNEEYMSRLYETQVKKIVKVQCMLRAFL
ARKTVASKTTKNRYAARAEQAVKKAPAKPEPSRTESTLRQSTIKKQASREMSQDEAALVL
QKAYRGRQVRKEVAPLLSQDLNLDPETMDMMRFYTSKWRYKSIFQVLLHYRAARYQDLVH
FSQQVHLYNQAVVGALQTSNERVPLERIEPHDNPDAFLGPSRPPDVHKLPFNIHSELPFY
DTSHMHDPTKARRRQGSVTSSMSDEEQNWDEPLKRQTIWGNIRRNKRDVQCQTTNSPHRD
INTSSHGGQSLINTPFSRDPSVPVRCPPEEAQAQSRATTGFQAPIDSRSPVRPINAHAPR
SNDHDNTGSIRSRKKVPPPPIPINKMQVPPTQSRSYNSYNNEARNRNATNDWAAEDRMNR
NDRVNPIQELQMIGRRNNNNDTGDDPPFNFQAMLRKTSHQRNSMKRTPVYDSYGSSQPMN
FRSGRGDMNESNVVYRSGGGNRAESPEWSPNEMVRMSEKYGREGAWGGGSGGRGAFELAN
TSESVTAELAPGIIVEGFVSDL
NT seq 4929 nt   +upstreamnt  +downstreamnt
atgagcgagtacggtagacgtggcggcggcggcgctcgccacggcagggacgaggaggag
gaggaggaggacgattgcgagtacgaggcgcgagaaaggagcagaggcagaggcagaagc
ggcggaggtggagatcgaggcggcggcggcggcggcggcggcggcggcagtggaccggag
aaactccagcggctggacagcatccaagacccgggcaagagatacgcgctgagagatcgc
atcggcagcggagtctgcggcgacgtgtacgaggccatcgacgaggaaggcagcaggaaa
gtcgccataaagatccagaagctcacgccggagacgcaacccttgatagtcgaggagtac
cgagtgctgcgcgacttctcgagccacccgaacctgccggacttctacggcgtgtaccgg
cggcgctcgggcaagaagacggagtacgatcaaatatggttcgtcatggagttgtgcgac
ggaggccccgtcatcgatctcgtcaggggcttaaagatgaccgacaaaagaatgcgggag
gagcacattgcttatatactgagggaaaccattaaggcggtggtgcacctgcacgagaac
aacgtgctgcaccgcgacgtccgcgcgagcaacataatgctgacccgcgagggcgaggtg
aagctggtggactttggcctggcccgcatgatcaagggcgagatgggcaagcgctacacg
tgcatcggctcgcccaactggatggccccggaggtggtgatgagcaagagcgagcagagc
cacggctacggcagccgcgccgacgtctgggccatcggcatcactgccatcgagctcggc
gacgggcacccgcccttccaggacatgcacccgaccagggcgctcttccagatcgtccgg
aatccaccgccgacgctctacaggccggccaactggacgcagaatttcaacgactttatc
gccgagtgcttggaaaagaatccggacaaccggcccttcgtcgcggaaatcgtcgagcat
cctttcctctcggagctgcccgagaatgactacccgctgactcaggagatcaaggctctg
gcggccaacctgagcggcaagggcaagcgcgacaggaagccggagtcgatcgtgaggaag
ggctacctcaagacccaccaaacccagctgcccgagcgcatgcaccaggaggatctcgcc
gcgctggaacaactcaccgaggaccgcgtgctggacgagctgcaggagaggctgcgccag
ggctccttccacaccttcgtcggcgacgtcctgctgatcctgaacccgaacgaggagcaa
gacatctacgggcccatctaccacaccaagtaccagaacaaatcgcgctcggacaactcg
ccccatatatactcggtcgccgacagcgcctatcaggacgtcctccatcacgaggaaccg
cagcacgttttattcgccggcgagagtaactccggcaagaccacaaacatgatgcacctc
gtccggcatctcatgtacctgggcaagagcctcaaagacactggcgcgagggtcatcaag
gcgataagcttgatacactcgttcaccaacgcggccactcctctcaacacgaactcgacg
aggtgcgtcttccagatacagacgacctacggatcgacgggcaaggcctcgggtgccatc
ttctgggtctaccagctggagaagttccgcgtctccacgagggacaggaaccagtcgaac
ttccacgtcttctactacttctacgacgggctggaggcctccggcaatctgcgccagtac
ctcctgccgcagggccgccgcatgcgctacctgcgcgtctacgagcaggactcggtgtcg
gggcgcaagcgctcgttcaaggtgcgcaacgaccctcacggcaacgcccgcaagttcgag
cacatcaaggagtgcctgaaggccctcgagctcgaggagcactgcgagacgatctggcgc
acactggcggccgtgctgaacctcggcgacgtgcgcttcatcgagggcaacggcggcgag
gccgaggtgcacaacatcgagaccgccaggtcggtcgccgagctgctccaactcgacgtg
aagaagttcacgtggtccctctgcaactactgcgtggtcaagaagggcgcggccgtgcgc
cgccggcacacctgcgacgaggccaaggaagcccgcgacgtgctggctaacacgatttac
cagcgattagtcgactggatcgtcaacaacatcaacgagaagctcagcgtctcgcgcacc
ctcttcggagacaagttcctcatcagcatcctcgacctcttcggcttcgagtgcttctcg
aagaaccggctcgagcagctgctcgtcaacacgatgaacgagcagctgcagtgccactac
aaccagcgggtcttcgtctgggagatgcaagagcaggaggaggaggaaatcccgatcgag
cgcttccacttctacgacaacaagcaggcgatcgaccagctgatgggcaagaccgacggg
ctgttctacgtgctcgacgaggcgtcccgccagctccaggacaccaactacatcttcgag
cgcatccagggccgcaggagcgccagcagcacccagcacgtcaaggtgcaggccggccag
gagttcagcgtcgcccactacacgggcaagctcagctacgacgcgtcggagatcgcggag
aagaaccgcgacttcgtcccgccggagatgatcgagacgctgcggcagtcctcccacgcc
gtggtcaaggagctcttcacgaacaagctgagcaaggccggcgcgctgaccatcgtctcg
caggagaagcccaaggacaaggagaagccgaagaagaccaccgccaggagcaagtgggga
gccgcgctgctgcactcggaccagacgaccaacctcaggaagtacaacacagcctccaga
ggccagtactcgcagacgaggaagatgcggacgtacgcggcgaccttccgcgcctcgagc
ctcgagatcctgaagaacctgtcggtcggcgcggtaagcggcgggacccacttcgtcagg
tgcatccgctccgacctggagggccagccgcgcggcttctaccgggaggtcgtcaggcag
cagatccgcgctctcgccgtgctggacactgccaaggccaggcagcggggctaccccttc
agaataaccttccaggagttcttgcgaagatacaaattcctggcgttcgacttcgacgag
aacgtcgagatgagccaggacaactgccgcctgctgctggtcaggctgaagatggagggc
tggattatcggcaagagcaaggtcttcctcaggtactacaacgaggagtacatgtcgcgg
ctgtacgagacgcaggtgaagaagatcgtgaaggtgcagtgcatgctgcgggccttcctc
gcgcgcaagaccgtcgcctccaagaccacgaagaaccgatacgccgcccgggccgagcaa
gctgtaaagaaagcaccggccaagccagagccgagccggacagagtcgacgctcagacag
tcgacgataaaaaagcaagcgagtcgggagatgtctcaagacgaagcagccttagtgttg
cagaaagcgtacagaggacgccaagtccgaaaagaagtcgcaccccttctgagccaggat
ttgaatctggatccggagacgatggacatgatgaggttctacacgagcaagtggcggtac
aagagcatattccaagtcctcctacactaccgtgcagcccggtaccaggacctcgtccac
ttcagtcagcaagtccatctatacaatcaagcggtagtgggggctctgcagacgagcaat
gagcgcgtgcccctagagaggatcgaaccgcacgacaaccccgatgctttccttggccca
tctcgaccgccagatgttcataagcttccattcaacattcacagcgaactgccattctac
gacaccagtcacatgcacgacccgacgaaggcgcgcaggagacaaggatccgtaacgtcg
tcgatgtcagacgaggagcagaattgggacgagccgttgaagaggcaaaccatttggggc
aacatcagacggaacaagagagatgtacaatgccaaacgaccaactccccccatcgcgat
ataaacacctcgagccacggggggcagagtctgatcaacactccattttccagggacccc
agtgtcccagtccgatgccctccagaagaagcccaagcccagtcgagagccactacaggt
tttcaggcgcctatcgacagccgtagtcccgtgcgaccgatcaacgctcatgctcctcgc
tcaaatgaccatgataataccgggtctatccgctctaggaagaaagtgccaccacccccg
atcccaatcaacaaaatgcaagtgccgcctactcaatcgcgaagctacaatagctacaat
aatgaggctcgtaataggaacgccacaaatgactgggcagctgaggacaggatgaacagg
aacgatcgtgtgaacccgatacaagaactgcagatgatcggccgaaggaataacaacaac
gacactggagacgatcctccattcaacttccaggcaatgcttcggaaaacgtcgcatcag
cgcaactcgatgaagcgcactccggtgtacgacagctacggctcgtcccaaccgatgaat
ttccgctccggccgcggcgacatgaacgagtcgaacgtggtctacagaagcggcggaggc
aacagggcagagtctcccgagtggagccccaacgaaatggtgcggatgtcggagaaatac
ggccgggagggcgcctggggaggaggcagcggcggacgcggtgctttcgagctcgcgaac
acgagcgaaagcgtcaccgcggaactcgcgccgggaatcatcgtagagggcttcgtctcc
gatctgtga

DBGET integrated database retrieval system