KEGG   Nasonia vitripennis (jewel wasp): 100119540
Entry
100119540         CDS       T01081                                 

Name
(RefSeq) long-chain fatty acid transport protein 4
  KO
K08745  solute carrier family 27 (fatty acid transporter), member 1/4 [EC:6.2.1.-]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Brite
KEGG Orthology (KO) [BR:nvi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:nvi01004]
    100119540
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:nvi02000]
    100119540
Enzymes [BR:nvi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.-  
     100119540
Lipid biosynthesis proteins [BR:nvi01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   100119540
Transporters [BR:nvi02000]
 Solute carrier family (SLC)
  SLC27: Fatty acid transporter
   100119540
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-GeneID: 100119540
NCBI-ProteinID: XP_008204870
NASONIABASE: NV14861
UniProt: A0A7M7H2M5
Position
2
AA seq 629 aa
MTSVHQILGTLVALLMLIVFLLSERRRRFLEILYRTLPRDILGAFRFLKVNALLWWWETR
GFTVAGIFTRLAAAHPEKIAYIFEDKEWTYQQLEDFSNRVGRYFRAKPMSRGDSIALVME
SRVEYVGTWLGLSKAGYVTALVNTNLRGDVLVHSINVAGCKAVIFSGEFKEAISEIKEKI
PDLALYQWSEHSDTILLEGASDLSTGLAEADSEPLFVDLSLGCPRDKLIYIYTSGTTGLP
KAAVINNLRYMLMSCGVYSMLGLKSTDRIYDSLPLYHTAGGIVGAGQALLRGITVVLRRR
FSASKFWPDCVHYECTVAQYIGEICRYLLAVPASSADTSHKVRLMYGNGLRPQIWKPFVE
RFRVKQIGEFYGATEGNSNLVNIDNRIGAVGFVPRYAGSLYPVALLKVDESTGEPIRGPD
GLCILCQPGEPGVFVGKINPKKAVNDFSGYVDKKASEKKIIHDVFKKGDRVFNSGDLLVM
DEYGYFYFKDRTGDTFRWRGENVATSEVEAVISNVIGLKDAVVYGIEVPGNEGKAGMAAI
YDPDQNINFNELAEGVKKALPTYARPLFVRVLASLPMTGTFKLKKKELQQEGIDIHKVKD
PIYFLEKSGKYVKLTEDLYNDIKQEKVRL
NT seq 1890 nt   +upstreamnt  +downstreamnt
atgacgtcggtgcaccagatcctaggcacgctcgtggcgctgctgatgctcatcgtcttc
ctgctgtccgaaaggcgacgcagattcctcgagatactctacaggacactgccaagggac
attttaggtgccttcagatttttaaaagtcaatgcccttctctggtggtgggagactcga
ggcttcacagtagccggtatcttcacgagactcgccgctgctcatccggagaagatcgct
tacatcttcgaagataaggaatggacttatcagcagctggaagacttcagcaaccgggtg
ggtcgatacttccgagcgaagccgatgtcccgaggtgacagcatcgccctggtgatggag
agccgagtcgagtacgtcggcacttggctgggtctcagcaaagccggctacgtaactgcc
ctcgtgaacacgaacctacgcggggacgtccttgtccacagcatcaacgtcgccggctgc
aaggccgtcatcttcagcggcgagttcaaagaagccatcagcgagataaaggagaagatc
ccggatctggcgctgtaccaatggtcggagcactcggacacgattctgctggaaggcgct
tctgacctgagcactggtctggccgaggccgattcggaacctctcttcgtcgacctctcc
ctcggctgtccccgtgataagctcatctatatctacacgtccggcacgacgggcttgccc
aaggctgctgttatcaacaatttaagatacatgctgatgtcgtgcggtgtttactcgatg
ctgggcctcaagtcgaccgatcgtatttacgactcgctgccgctctatcacacggccggt
ggcatcgttggtgctggacaggctcttctcagaggcattaccgtggtgcttcgtcgacga
ttcagcgcctccaagttctggcccgattgcgtccactacgagtgcacggttgcgcaatat
atcggggaaatatgccgctatctgctcgccgtaccggcgagctcggccgacacttcgcac
aaagtgcggctcatgtacggaaatggactacggccacagatctggaagccgtttgtggag
agattccgcgtcaagcaaattggagagttctatggtgctacggagggcaactcgaatctc
gttaacatcgacaacagaatcggtgcggtgggcttcgttccgcgttacgccggttccctg
tacccggtcgccctgttgaaggtcgacgagtcgaccggtgagcccataagaggtcccgat
gggctatgtatcctctgccagcctggagaacccggtgtttttgtcggcaagatcaatccc
aagaaggccgttaacgacttcagcggctatgtcgacaaaaaggcctcggagaagaagatc
attcacgacgtcttcaaaaagggagatcgcgttttcaattctggagacctcttggtgatg
gacgagtacggatacttctacttcaaggatagaaccggagatactttcagatggcgagga
gagaacgtcgctacttcagaagttgaagcggttatcagcaacgtcattggactaaaggat
gcagtggtctacggcattgaggttcccggaaatgaaggaaaggccggaatggcagcaatc
tacgatcccgatcaaaacatcaatttcaacgagttggccgaaggtgtgaagaaagctttg
ccaacgtatgcaaggcctttattcgttcgtgtcctcgctagtcttccaatgacaggaacc
ttcaaattgaaaaagaaggagctgcagcaagagggaatcgatattcacaaggtgaaagat
ccaatctactttttggaaaagtccgggaagtacgtcaagctcacagaagacctgtacaac
gatatcaagcaagaaaaagttcgactataa

DBGET integrated database retrieval system