KEGG   Nasonia vitripennis (jewel wasp): 100119627
Entry
100119627         CDS       T01081                                 

Name
(RefSeq) eukaryotic translation initiation factor 2 subunit 1
  KO
K03237  translation initiation factor 2 subunit 1
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
nvi04140  Autophagy - animal
nvi04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:nvi00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100119627
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100119627
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:nvi03012]
    100119627
Translation factors [BR:nvi03012]
 Eukaryotic type
  Initiation factors
   eIF-2
    100119627
SSDB
Motif
Pfam: EIF_2_alpha S1 Nic96 DUF4453 DOG1
Other DBs
NCBI-GeneID: 100119627
NCBI-ProteinID: XP_001603365
NASONIABASE: NV15947
UniProt: A0A7M7G423
Position
2
AA seq 334 aa
MVLSCRFYKEKYPEVEDVVMVNVRSIAEMGAYVHLLEYNNIEGMILLSELSRRRIRSINK
LIRVGKTEPVVVIRVDKEKGYIDLSKRRVSAEDVEKCTERYAKAKAVNSILRHVAELLNY
ESDDQLEELYQKTAWHFEEKYKKQKASAYDFFKQSVLDPSILAECDLDERTKEVLLNNIK
RKLTSQAVKIRADVEVACYGYEGIDAVKAALKAGLALSTDELPIKINLIAPPLYVMTTST
PEKTDGLKALSDAIEVIKEKIVSMGGVFNVQMAPKVVTATDDAELAKQMERAELENAEVA
GDDDEEENEGMGNFSGGEDNDENDEKDKESAEED
NT seq 1005 nt   +upstreamnt  +downstreamnt
atggtgttatcttgtcgattttacaaagaaaagtatccagaggtggaggatgttgttatg
gtcaacgtccgtagtatagctgaaatgggtgcctatgtgcatctattggagtataataac
attgaaggcatgatcttgctttctgaattgtccaggagacgtatccgttctattaataag
ttaattagggtaggaaaaacagaaccagttgttgtcattcgtgttgacaaggaaaaaggt
tacatcgatttaagtaaaagaagagtgtcagctgaagacgttgaaaagtgtacagaacga
tatgctaaagcaaaggcagtgaactctattttgagacatgttgcagaactattaaactat
gaaagtgatgaccaattagaagaactgtatcaaaagacagcatggcacttcgaagagaag
tacaagaaacaaaaagcatctgcttatgacttctttaaacaatcagtattggatccgtca
attttagcagagtgtgatcttgatgaacgcacaaaagaagttttgttgaacaatatcaaa
agaaaattgacttcccaagctgttaaaataagagcagatgttgaagtagcttgctatgga
tatgaaggcattgatgctgtaaaagcagcactgaaagctggcttggccttatccacagat
gagcttccaattaaaattaatttaatagcacctccactttatgttatgacaacttcaacc
ccagaaaaaacagatgggttaaaggcattaagtgatgctattgaagttatcaaagaaaaa
attgtgtcaatgggtggtgtgttcaatgtgcaaatggctcccaaggtcgttacagccact
gacgatgctgaactggccaaacagatggagcgagctgaactcgaaaatgcggaagttgct
ggtgacgatgatgaggaagagaatgaaggcatgggtaacttcagtggtggagaagataat
gatgaaaatgatgaaaaggataaggaatctgcggaggaagattaa

DBGET integrated database retrieval system