KEGG   Nasonia vitripennis (jewel wasp): 100119832
Entry
100119832         CDS       T01081                                 

Name
(RefSeq) V-type proton ATPase subunit D
  KO
K02149  V-type H+-transporting ATPase subunit D
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
nvi00190  Oxidative phosphorylation
nvi01100  Metabolic pathways
nvi04145  Phagosome
nvi04150  mTOR signaling pathway
Module
nvi_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:nvi00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    100119832
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    100119832
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100119832
SSDB
Motif
Pfam: ATP-synt_D
Other DBs
NCBI-GeneID: 100119832
NCBI-ProteinID: XP_001600508
NASONIABASE: NV16729
UniProt: A0A7M7G1U6
Position
4
AA seq 248 aa
MSGKDKLAIFPSRGAQMLMKSRLAGAQKGHGLLKKKADALQMRFRMILGKIIETKTLMGE
VMKEAAFSLAEAKFATGDFNQVVLQNVTKAQIKIRSKKDNVAGVNLPVFESYQDGTDTYE
LAGLARGGQQLAKLKKNYQKAVTLLVELASLQTSFVTLDEVIKITNRRVNAIEHVIIPRI
ERTLAYIISELDELEREEFYRLKKIQDKKKIAKAKVEAIRREMIAAGKDDDRGGVANMLD
EGDDDILF
NT seq 747 nt   +upstreamnt  +downstreamnt
atgtcgggaaaggataaacttgctattttcccctctcggggagcccaaatgttgatgaag
tctcggttagccggtgcacaaaagggtcatggtcttcttaaaaagaaggcagatgctctg
caaatgcgtttcagaatgattttgggaaaaatcattgagacaaagacactaatgggggag
gtgatgaaagaagcagctttttctctggcagaagcaaagtttgcaactggtgatttcaac
caagtggttctgcaaaatgtcacaaaagcacaaattaagattcgctcaaagaaagacaat
gtggcaggtgtcaatcttccagttttcgagtcataccaagatggaacagatacttatgaa
ttggctggtttggccagaggaggtcaacagctggccaaattgaagaagaactaccagaag
gcagtgacactgctagtagagctggcctctctgcaaactagttttgtaactcttgatgaa
gtaatcaagatcacgaatcgtcgtgtcaatgctattgagcacgttatcattcccaggatt
gagaggactctggcttatattatatcagagttggatgagcttgagagagaagagttttac
cgcttgaagaagattcaagataagaagaagatagctaaagctaaggttgaagctattcgg
agagaaatgattgctgctggaaaagatgatgatagaggaggtgttgctaatatgctagac
gagggcgatgatgatatattgttctaa

DBGET integrated database retrieval system