KEGG   Nasonia vitripennis (jewel wasp): 100119940Help
Entry
100119940         CDS       T01081                                 

Definition
(RefSeq) choline/ethanolamine kinase
  KO
K14156  choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
nvi00564  Glycerophospholipid metabolism
nvi01100  Metabolic pathways
Module
nvi_M00092  Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    100119940
Enzymes [BR:nvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     100119940
    2.7.1.82  ethanolamine kinase
     100119940
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Choline_kinase APH EcKinase Kdo Herpes_UL4
Motif
Other DBs
NCBI-GeneID: 100119940
NCBI-ProteinID: XP_008212900
NASONIABASE: NV17197
Position
1
AA seq 396 aa AA seqDB search
MRIVAIIRRIVLADCSEETGDRLSNMSEHNPEMRATAARICRDYLHGVWKHVTPDNIVLK
RISGGLSNWLYNVQLPEGAIPVRGEPRQVLLRLYGQVHGERAFEGLITESVIFTLLSERR
LGPKLHGIFPGGRIEEYIPARPLLTKELADPCISSLIAEKMAQIHTMQVPISKEPTWLWD
TMYKWLDTATNILENVEDIESKQLDHVTFIKSIDLEQEISWFRSLVKQQKHPVVFCHNDM
QEGNILMRQNSKTELVVIDFEYCSYNYRGFDVANHFLEWQYDYTSADYPFFTERSGSGST
KEQKLNFIRSYLRSAGKEGQAEEDRMMAEIKLFSLASDLFWGLWSIVNAKLSQIPFGYWD
YAVARLRHYQYLKEKILVSGPHFPDGGVKRKVTQLD
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgcggattgtcgcgatcatacgtaggattgtactggcggattgttccgaggaaacgggc
gatcgattatctaacatgtctgagcacaacccggaaatgagggctacagcagcgcgcatt
tgccgtgattatttgcatggagtatggaagcacgttaccccagacaacattgttctgaag
aggattagcggtggtctgagcaactggctatacaatgtccaattacccgagggcgcgata
ccggttcgtggcgagcccagacaggttcttctgcgactctacggtcaagtgcatggcgag
cgagccttcgagggcctgatcaccgaatccgtcatcttcacacttctttcagagaggcgg
cttggtcccaagcttcacggtatcttccccggtggcaggatcgaggagtacataccagct
cgtcccttactcactaaagagttggctgatccttgcatcagttcgctcatcgccgagaaa
atggcacagatacacacgatgcaggtgcccatcagcaaggaacccacttggctctgggat
acgatgtacaagtggctggacaccgcgacgaacatactggaaaacgtcgaggatatcgaa
agcaaacaacttgatcacgtgaccttcatcaaaagcatcgatctggaacaggagatatcc
tggttcagatcgctagtcaaacaacaaaagcatcctgttgtcttctgtcataacgacatg
caggagggcaacattcttatgcgacaaaactcgaagactgaactcgtggtcatcgacttt
gaatactgttcttacaactacaggggcttcgatgtggcaaaccacttcctcgaatggcag
tacgactacacgtcggcggactatccattcttcaccgagagatcgggctccggatccacc
aaagagcaaaagctcaatttcataagaagttacttgcgaagtgctggaaaagagggacag
gcagaggaagatcgcatgatggcagagattaagctgttctccctcgctagcgacttgttc
tggggactgtggagtatcgtcaacgccaagctctctcaaattccattcggatactgggat
tacgccgttgcaaggctgaggcactaccagtacctgaaggagaagatcctggtgtcgggc
ccgcacttccccgacggcggggtcaagagaaaagtgacacagctggattga

DBGET integrated database retrieval system