KEGG   Nasonia vitripennis (jewel wasp): 100120006
Entry
100120006         CDS       T01081                                 
Name
(RefSeq) alpha,alpha-trehalose-phosphate synthase [UDP-forming] isoform X2
  KO
K16055  trehalose 6-phosphate synthase/phosphatase [EC:2.4.1.15 3.1.3.12]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
nvi00500  Starch and sucrose metabolism
nvi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nvi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100120006
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:nvi01003]
    100120006
Enzymes [BR:nvi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.15  alpha,alpha-trehalose-phosphate synthase (UDP-forming)
     100120006
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.12  trehalose-phosphatase
     100120006
Glycosyltransferases [BR:nvi01003]
 Others
  Trehalose
   100120006
SSDB
Motif
Pfam: Glyco_transf_20 Trehalose_PPase Glycos_transf_1
Other DBs
NCBI-GeneID: 100120006
NCBI-ProteinID: XP_001603693
NASONIABASE: NV13394
UniProt: A0A7M7G594
Position
2
AA seq 786 aa
MIVVSNRLPFVLKRNETSGKLERKASAGGLVTAVAPVVINGNGVWVGWPGMHMENRNEPI
PESDPNDRTPTAGLLSRKVVAVHVEPTIFDSYYNGCCNGTFWPLFHSMPDRATFIADHWK
AYSAVNEEFAAKTVGALEQIHKEQAGQGNGTPLVWVHDYHLMLAANWIRQAADEKNLKLK
LGFFLHIPFPPWDIFRLFPWADEILQGMLGCDMVGFHIQDYCLNFVDCCQRSLGCRVDRK
NLLVEHGGRTVRVRPLPIGIPFDRFVSLAETAPKVMLTNQKIILGVDRLDYTKGLVHRLK
AFEMLLEKHPEHREQVTMLQIAVPSRTDVREYQDLKLEMDQLIGSINGRFTTPNWSPIRY
IYGCVSQDELAAFYRDAAVALVTPLRDGMNLVAKEFVACQINTPPGVLIVSPFAGAGEMM
HEALICNPYEIDEAAEVIHRALTMPEDERTLRMNHLRRREKAYDVNHWMKSFLQVMGSLE
ERDSVGATVMQPVTMDDFDDYLSKYIGENHKLALLLDYDGTLAPIATHPDLATLPLETKN
VLQRLSNLPDVYIAIISGRNVNNVKSMVGINGITYAGNHGLEILHPDGSKFVHPMPAVFE
SKVASLMQALQDQLCKDGAWVENKGALLTFHYRETPMERRPSMIEHAKKLIEDAGFKACS
AHCAIEAKPPVEWNKGRASIYILRTAFGLDWSERIRIIYAGDDATDEDAMKALKGMAATF
RVASSHIIRTSAERRLPSTDSVLTMLKWVERHLSRRKPRNNNDVSSKFRRGHSGITMEMS
FTQPSA
NT seq 2361 nt   +upstreamnt  +downstreamnt
atgatcgtcgtgagcaacaggttgcccttcgtcttgaagaggaatgagacttcggggaag
ctcgagcgcaaggccagcgccggtggccttgtcaccgcggtcgcaccagtggtgataaac
ggaaatggagtctgggtcggatggccaggaatgcacatggagaaccggaacgagccgatc
ccggaatccgatccgaacgacagaacgcccaccgctggtctattgtcgagaaaggtcgtg
gcagtgcacgtggagccgacaatcttcgactcgtattacaatggctgctgcaacggcact
ttctggccactattccactcgatgcccgacagagccacttttatcgccgaccactggaag
gcttacagcgccgttaacgaggagtttgccgcgaaaacggtcggagctttggaacagatc
cacaaggagcaagcgggtcagggcaacggcacacccctggtctgggtgcacgactatcac
ctcatgctggccgccaactggatcagacaagccgccgacgagaagaacctaaagctcaag
cttggtttcttccttcatattccattccctccatgggacatcttcagactcttcccctgg
gccgacgagatcctccagggaatgctaggatgcgacatggtgggcttccacatccaagac
tactgcctgaacttcgtagactgctgtcagcgcagcttgggctgcagagtcgaccgcaag
aacctgctggtcgagcacggcggtcgtaccgtcagggtgagacctttgccaatcggtata
cccttcgatcgtttcgtctcgctggccgagaccgcgccgaaggttatgctgaccaatcaa
aagatcatccttggcgtcgaccgacttgactacaccaagggacttgtgcacagactcaag
gccttcgagatgctgctggagaagcatccggaacaccgggaacaggtgacgatgctgcaa
atcgccgtgccatctcgtacggacgtccgcgagtaccaggatctgaagctcgaaatggat
cagctgatcggcagcataaacggccgctttaccacacccaattggtcgcccatacgctat
atttacggctgtgtcagtcaagacgagttggctgctttttacagagatgccgccgtggct
ctagtgactccgctcagagatggcatgaacctcgtggctaaggagttcgtcgcctgccag
atcaacactcctcctggtgtgcttatcgtttctcccttcgccggtgctggagagatgatg
cacgaggcactcatttgtaacccatacgagatcgacgaggctgctgaagtcattcacaga
gcgttgactatgccagaggacgagcgcacgctgagaatgaaccacttgcgccgtcgcgag
aaggcctacgatgtgaaccattggatgaaatcgttcttgcaggtgatgggctcgctcgag
gagcgtgattccgttggtgctacggtcatgcagccggtgacaatggacgacttcgacgat
tacttgagcaagtacattggtgagaatcacaagctggcactgcttctggattacgatggt
accttggccccgatcgcaacccatccagacctcgcgaccctaccactcgagacgaagaac
gtgctgcagaggctgtccaatcttccagacgtctacatcgccatcatctccggaagaaac
gtcaacaacgtcaaatccatggttggaatcaatggtatcacctacgctggtaaccacgga
ctggaaattctgcatccagacggcagcaaattcgttcatccgatgcctgcggtgttcgag
agcaaggtcgctagtctcatgcaagcccttcaggatcagctgtgcaaagacggcgcctgg
gtagagaataagggagctctgctgactttccattaccgcgaaacgccgatggaacgtcgc
ccatcgatgatcgaacacgcaaagaagttgatagaagacgctggtttcaaggcatgttca
gcgcattgcgccatcgaggccaaaccaccggtagaatggaacaaaggtcgcgcctctatt
tacatcttgcgcacagctttcggcctcgactggagcgagaggatcaggatcatctatgct
ggtgacgatgcgacagatgaggacgccatgaaggctctgaaaggtatggctgcgacattc
cgcgttgcctcatcgcacataattcgtacatcagcagaacgccgtctgcccagcaccgac
tccgtcctcacgatgcttaagtgggttgagagacacctaagccgcagaaagcctcgcaac
aacaatgacgtatcatccaagttccgtcgcggacactccggcattaccatggaaatgtcc
tttacgcagccctcggcgtaa

DBGET integrated database retrieval system