KEGG   Nasonia vitripennis (jewel wasp): 100120053Help
Entry
100120053         CDS       T01081                                 

Definition
(RefSeq) UDP-glucuronosyltransferase 2C1-like
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
nvi00040  Pentose and glucuronate interconversions
nvi00053  Ascorbate and aldarate metabolism
nvi00830  Retinol metabolism
nvi00860  Porphyrin and chlorophyll metabolism
nvi00980  Metabolism of xenobiotics by cytochrome P450
nvi00982  Drug metabolism - cytochrome P450
nvi00983  Drug metabolism - other enzymes
nvi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100120053
   00053 Ascorbate and aldarate metabolism
    100120053
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100120053
   00860 Porphyrin and chlorophyll metabolism
    100120053
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100120053
   00982 Drug metabolism - cytochrome P450
    100120053
   00983 Drug metabolism - other enzymes
    100120053
Enzymes [BR:nvi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     100120053
Glycosyltransferases [BR:nvi01003]
 Others
  Hydrophobic molecule
   100120053
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C Glyco_transf_4 SieB Glyco_trans_1_3
Motif
Other DBs
NCBI-GeneID: 100120053
NCBI-ProteinID: XP_001603733
NASONIABASE: NV18591
Position
2
AA seq 529 aa AA seqDB search
MLSTQSKMLTILIVLACSSQSIDGLRILGLFPLHGKSHFVMCERLVKHLAQQGHQLDVYS
HFPFKKPIPNHKDFSLNGTLPAVVNNMTYDFFKQFQSVDMAAMMSNVGNPVCELLSTPVF
QDLFKSLEKNQPYDLVIIEVFVSNCFLAWGRRLNVPMIGVMTSTLIDWYNEPLGNPFNPA
ATPGCWSGLFHPMNFWERLINTIMYHMISAQFNYHIKAQNKYVEQHFGHGYPDVTELPRD
LDLLLVNTHHSLDGVRAFTPAIIPVGGLHIVDDGEKLPEKVLKWLDESKDGCIYFSFGSM
VRIETFPKPILAAIYATFKNIAPVRVLMKIAKPEDLPPGLPSNVMTQSWFSQLQVLKHKN
IKAFVTHGGLMSTQESLYAGVPMIGVPLFGDQHLNVRVQARQEIAVFVNHEEITEQSFTA
AVKEILNNPIYKKNAESFSKKFFDRPMSPIDTATFWIEYVARHGKNALRSPVVDMPWWQV
NLIDVYGFILLVLIIIGYIIKVVVKKILKFCCSSKSEDKRSKKAAKKIQ
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgctctccacacaaagcaaaatgttaacgattcttatcgtgctcgcctgcagcagtcag
agcatcgatgggctaagaatcttgggcttatttccgttgcatggaaaaagtcactttgtt
atgtgtgaaagattagtcaaacatttagctcagcaaggacatcaattagatgtctacagt
cattttccatttaaaaaacctattccaaatcacaaggactttagtctcaatggcacttta
ccagctgtagtcaataacatgacgtatgactttttcaaacaatttcaatcagttgacatg
gctgcaatgatgagcaatgtgggaaatccagtttgtgaattgttaagcacaccagtattt
caagacctttttaaaagtttggaaaaaaatcaaccttacgacctcgttattattgaggta
ttcgtatcaaactgtttccttgcatggggacgtcgtctaaatgttccgatgatcggtgta
atgacaagtactctaattgattggtataatgagccacttggaaatccattcaaccctgca
gcaacaccaggctgctggtcaggtcttttccatcccatgaatttctgggaacgattaatc
aacacaattatgtatcacatgatatcggcacaatttaattatcatattaaagcccaaaac
aagtacgttgagcaacatttcggccacggataccctgatgtcactgaacttccacgagat
ttagatttactacttgtaaatactcatcattctctcgatggtgtacgagcattcacccct
gcgatcataccagttggaggcttgcacattgtggacgacggtgaaaaactacccgaaaaa
gtactaaagtggttagacgaaagtaaagatggctgcatttacttttcatttggatcaatg
gtcagaatcgaaacattccccaagcctattctagctgctatttatgcgaccttcaaaaat
atcgctccggttcgtgttttgatgaagatagccaagcctgaagacttgccaccaggactt
ccgtcaaacgttatgacgcaatcgtggttctctcaattacaagtcctgaagcacaaaaat
atcaaagcattcgtcactcatggcggactcatgagcacgcaagaatcactgtacgccggt
gtgccaatgataggcgttccgttattcggcgaccaacacttgaatgtgagggttcaagcg
cgccaagaaattgccgtattcgttaaccacgaagaaatcacggagcaatcattcacagca
gctgtcaaagaaattttgaacaatccaatttataagaaaaatgctgaatcattttccaag
aaattcttcgaccgaccgatgagcccaattgacacagccacgttttggattgaatacgtc
gcacgtcatggcaaaaacgccttaagatcgcctgtagttgatatgccttggtggcaagtt
aacttgattgacgtctatggctttattttactcgtgcttataatcattggctacattata
aaagtagtagtgaaaaaaatattgaaattttgctgctcttcaaaatccgaggataaacga
agtaaaaaggctgcaaaaaagattcaataa

DBGET integrated database retrieval system