KEGG   Nasonia vitripennis (jewel wasp): 100120382
Entry
100120382         CDS       T01081                                 

Definition
(RefSeq) adenylate kinase isoenzyme 6
  KO
K18532  adenylate kinase [EC:2.7.4.3]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
nvi00230  Purine metabolism
nvi01100  Metabolic pathways
nvi03008  Ribosome biogenesis in eukaryotes
Module
nvi_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:nvi00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100120382
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    100120382
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:nvi03009]
    100120382
Enzymes [BR:nvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.3  adenylate kinase
     100120382
Ribosome biogenesis [BR:nvi03009]
 Eukaryotic type
  Pre-40S particles
   Export and cytoplasmic maturation factors
    100120382
SSDB
Motif
Pfam: AAA_18 AAA_28 AAA_16 SKI AAA_5 AAA AAA_22 AAA_17 AAA_33 RuvB_N Cytidylate_kin NTPase_1 Sigma54_activ_2 Zeta_toxin
Other DBs
NCBI-GeneID: 100120382
NCBI-ProteinID: XP_001604028
NASONIABASE: NV16667
UniProt: K7J5L9
Position
3
AA seq 176 aa
MSNSSRKLPNILVTGTPGVGKSELSRLLAERTGFGWLDVSKLAIEHKCLESFDEEYQCPV
LDEDKLLDLMEPMMAEGGKIVDYHGTDFFPERWFDIVFVLRTNNTILYDRLVARGYSGKK
LEDNIDCEIFQTLLIEAKESYKEEIVHELQSNIPEQTIDNVNRICQWIEQWKLDNQ
NT seq 531 nt   +upstreamnt  +downstreamnt
atgagtaacagtagtcgaaaattaccaaatattctagttactggcacccctggtgttggt
aaaagtgaactgtcacgattattggcagagcggactggatttggttggttggacgtgagc
aaattagctatagaacataaatgtttggagtcctttgacgaggaatatcagtgccctgtt
ttggatgaggataagctcttagatttaatggaaccgatgatggcagagggaggaaaaatt
gttgattaccatggaacagattttttcccagaaagatggtttgacattgtatttgttttg
aggactaataacacaattttatacgatcgccttgtagctagaggctacagtggcaaaaaa
ctagaagataatattgactgtgaaatatttcaaacacttttgatagaagcaaaagaatcg
tacaaagaagaaatagttcatgaactacaaagtaacatacctgaacagaccatagataat
gtgaacaggatatgtcaatggatagaacagtggaaattagataatcaataa

DBGET integrated database retrieval system