KEGG   Nasonia vitripennis (jewel wasp): 100120440
Entry
100120440         CDS       T01081                                 

Definition
(RefSeq) stromal membrane-associated protein 1 isoform X4
  KO
K12486  stromal membrane-associated protein
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
nvi04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:nvi00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100120440
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:nvi04131]
    100120440
Membrane trafficking [BR:nvi04131]
 Endocytosis
  Arf GTPases and associated proteins
   Arf associated proteins
    100120440
 Endosome - Golgi transport
   Arf GTPase associated proteins
    100120440
SSDB
Motif
Pfam: ArfGap
Other DBs
NCBI-GeneID: 100120440
NCBI-ProteinID: XP_008211386
NASONIABASE: NV11393
UniProt: K7IQQ6
Position
4
AA seq 471 aa
MSRLEKERVKQIQDKCQTLLTQMLRDEDNKYCVDCDAKGPRWASWNLGIFLCIRCAGIHR
NLGVHISKVKSVNLDSWTPEQVVSLQQMGNSRARAVYEANLPDSFRRPQTDCSLESFIRA
KYEHKKYIAREWVPPPLPKVNWDKELDEEAERQRRRKKDSQKPTTQTALPPVKKPEVVPQ
IPKPRSSVSPKPNRSVPLPTATNSATLDLLGLDAPENQTSTNGSTSGDDIFTSFLSGPPA
SSSAPVSNGTSTESNSTNASAAASKSEEESFFNQPAPTPQEKSKMTKDSILALYGTQPSQ
PFGGNMFNQQMPAQQFQQPMSNVGAFNQPLNHSLQSQMGMPGVNQMNVAPNQMCMNPNQL
GAASGNPMANNSAMTMQAQMQQGVTNSGSQMVLGSNNGWSGMMTAQNLQPAPGSNPFLNL
GAQPTAAQLFGQQLPQQMSQMSLGGMGFPAAPGKPATASLPGQTLSTNLWQ
NT seq 1416 nt   +upstreamnt  +downstreamnt
atgtcgcggctcgagaaggaacgggtcaagcagatccaggacaagtgccagacactcctg
acgcagatgctccgcgacgaggacaacaagtactgcgttgactgcgatgccaaaggacca
agatgggcaagctggaacctcggcatattcctctgcatccggtgcgcgggtatccacagg
aacctcggcgttcacataagcaaagtcaagtccgtcaacctggattcctggaccccggag
caagttgtgagcttacaacagatgggaaactcacgagcgagggctgtgtacgaggcgaat
cttcccgacagtttccgaagaccccagaccgactgcagcttggagagcttcatcagagcg
aagtacgagcacaaaaagtacatcgcaagggaatgggtaccacccccattgcccaaggtc
aactgggataaggagctggacgaggaggcggagcgacagcgcagacggaaaaaagacagc
cagaaacctacgactcagactgcattgcctcctgtgaaaaagccagaagtagtgcctcag
ataccgaaaccgcgaagttccgtcagcccgaaacccaacagatccgtacctctgcccacg
gcaaccaactcggctacgctggacttactcggtctggatgccccagaaaatcaaacgagt
acaaatggctctacatctggagatgacatattcacatcgttcttgtcggggccacctgca
tcatcgtcggcacccgtgtcaaatggcacatcgacggagagtaacagtacaaatgcctct
gcggcggccagcaagtccgaagaggagagctttttcaatcagccggccccgacgccacag
gagaagagcaaaatgacgaaggatagtattctagcgttgtacggaactcagccgagtcaa
cctttcggaggtaacatgttcaatcagcaaatgcctgcccagcagttccagcagccaatg
tcgaacgtgggagcgtttaatcagcctctaaatcattccctgcagtcccagatgggcatg
cccggcgttaatcaaatgaacgtcgcgcccaatcaaatgtgtatgaatcctaatcaatta
ggtgccgcctcgggaaaccctatggccaataactctgccatgactatgcaagctcaaatg
cagcaaggtgtgacaaattctggttcgcagatggttctaggtagcaataacggatggagc
gggatgatgaccgctcaaaacttgcagcctgctcctggcagcaatccattcttgaatctg
ggtgcccagccaacggctgcccaactctttggacagcagcttccccagcaaatgtctcaa
atgtccctcggcgggatgggctttcccgctgcgcctggtaaaccagcgacagcgtcatta
ccaggtcaaacgctttcgacgaacctatggcagtaa

DBGET integrated database retrieval system