KEGG   Nasonia vitripennis (jewel wasp): 100120639
Entry
100120639         CDS       T01081                                 
Name
(RefSeq) xylulose kinase-like isoform X1
  KO
K00854  xylulokinase [EC:2.7.1.17]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
nvi00040  Pentose and glucuronate interconversions
nvi01100  Metabolic pathways
Module
nvi_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:nvi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100120639
Enzymes [BR:nvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.17  xylulokinase
     100120639
SSDB
Motif
Pfam: FGGY_C FGGY_N
Other DBs
NCBI-GeneID: 100120639
NCBI-ProteinID: XP_008211824
NASONIABASE: NV16967
UniProt: A0A7M7HER1
Position
4
AA seq 535 aa
MGEPQNSTFLGLDFSTQQLKAVVVDDNLNVLHETSVQYDNDLPEFRTYGGVLQTKEEPNV
ITAPTLMWVKALDMILDRLRVCGVDFSKVAAVSGSAQQHGTVYWSKGSRTTLQNLNPEKF
LHEQLVAAFAVSPAPIWRDASTSAECRLLEDAVGGPEKLAEITGSRGYLRFSGPQIAKIA
KRRPEAYESTERISLVSSFAASLFLGDFAPIDLADGSGMNLLDIRTKDWHDELLEVCAPN
LREKLEAPVPSSSDVGPISAYFVERFGFDEKCRVVAFTGDNPGSLAGLRISEGDIACSLG
TSDTLFVWLNDPKTVVDGHVFCNPIQDDAYMALVCFKNGSLTRERIRDSTAGKEWQLFDE
LLDNTPRGNFGNFAFYYDVEEILPRLVGDHRFNKANERIARYSSKEVEVRAVIEGQFVAR
RAHAEDFGFVIGPNTRIIATGGASNNKTILQVLADVFNSPVYVSEIANSAMMGAAYRAKH
ALFKDKLKFEDILNTLPEPKLVCQPYDDAESIYKPMVQRYRKLIEELLREAQPES
NT seq 1608 nt   +upstreamnt  +downstreamnt
atgggcgaacctcaaaactcgacattcctcgggctcgacttcagcacgcaacagttgaaa
gccgttgtagtcgacgacaatctcaacgtcctgcatgagacgagtgtccagtacgacaat
gacttgccggaattcaggacttacgggggcgttttacaaacgaaggaggagccgaacgta
ataacggccccgaccctcatgtgggtcaaggccttggacatgatactggataggctgaga
gtctgcggcgtcgacttcagcaaagtcgcggctgtttccggctctgcgcagcaacacgga
accgtgtactggagcaaaggaagtcgaacgaccttgcagaacctcaaccccgagaagttc
ttgcacgaacagctggtggcggcttttgcggtctcaccggcgcccatatggagggacgcg
agcaccagcgccgagtgccgactactcgaagatgccgttggtggacccgagaaactggcg
gaaatcacagggtcgaggggatacctgaggttctccgggcctcagatagccaagatcgcc
aagaggagacccgaagcttacgagagcacggagaggatatcgctggtaagcagcttcgcg
gcctccttgttcctgggcgatttcgcaccgatagacttggccgatggatcaggcatgaat
ttgttggacattcgaaccaaagactggcacgacgagcttttggaggtttgcgctccaaac
ctgagggagaagctcgaggcacccgtgccctccagctcggacgtcggtcccatttcggcc
tacttcgtcgagagattcggattcgatgaaaagtgcagagttgttgccttcacgggcgac
aatcctggatcactggccggactgagaatatccgaaggagacatagcctgtagcctcggt
acgagtgacacgctgttcgtgtggttgaacgacccgaagaccgtggtcgacggtcacgtg
ttttgcaatcctatccaggatgacgcttacatggctctggtctgtttcaagaacggctct
ctgactcgggaacgaatccgcgacagcacagccggcaaggagtggcagcttttcgatgaa
ctactggacaatacgcccaggggaaacttcggcaactttgcgttctattacgatgtggag
gagatcctgccacgactcgtcggcgaccacaggttcaacaaggctaacgagcgtatcgcg
agatacagttctaaggaggtggaggtcagggccgttatcgagggacagtttgtggctcgt
agggcgcatgccgaggactttggctttgttataggcccgaacactagaataattgcgaca
ggaggagcttccaacaacaaaactatcctccaagttctagccgacgtcttcaactcgccc
gtttacgtatcggaaatagcaaattcagcgatgatgggagcggcttacagagcgaagcat
gcacttttcaaagacaaactcaagttcgaggacatacttaacaccttgccggaaccaaag
ctcgtttgccaaccatacgacgacgcggagagcatttacaagccgatggtgcaacgctac
agaaaactgatagaggaactgcttcgggaggcacagccggagtcgtag

DBGET integrated database retrieval system