KEGG   Nasonia vitripennis (jewel wasp): 100120665
Entry
100120665         CDS       T01081                                 

Definition
(RefSeq) eukaryotic translation initiation factor 2-alpha kinase
Organism
nvi  Nasonia vitripennis (jewel wasp)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PQQ_2 Pkinase_fungal PQQ_3 Kinase-like Kdo DUF104
Other DBs
NCBI-GeneID: 100120665
NCBI-ProteinID: XP_001604278
NASONIABASE: NV12444
Position
2
AA seq 958 aa
MPRWSSWPSILLLLLAARTCAEIRQLPYCKDAVAAAPSRSLLYVSTLDGKLTALDASLEG
QKKWSLDFKKQPLLSSNIHRRDLNNNGQWVRLIPSLNGGLYKFDGENLEAVPVSVDQLLQ
SSFRYSDDLIFSGGKETKTYGISSTSGRILYECKMSSCTNKTNGESLVEEDVLIVRHHQH
TVRAGEPRTGIERWNFSVGQHDLTMLPRENADCHQEIPPVTLEIEIRTIVPEGLVIAYSK
TNPQIKLWEHKFDSPVVAVWRGDQVYENGAITPLKEVNLFESSQLDSELDAEFSLNPGLY
IGMHERQLYIQENPAFRRAIDHAPTELIKYPWRPYPAIEFSKDVGNDKSKEVPFEMSEVL
STTALSVLYNSEYINGNGFYLYSKEQIQLEGGSQCNGTGPKKNLVETSSPSPSIEYQEED
DTPVQVIIVSLWYWWREVVIISITTAILLNFMLTQRLLNATAETKDAILPPLIVERHVVE
TKPESLKSNSEDADANFNSRYLTDYEPLDCLGRGGYGVVFEARNKIDDCNYAIKRIALPN
SRYSRERVMREVKALAKLDHHNIVRYFNAWLECPPAGWQEEHDRQWSNHKKFPNSDFASE
SSIADTSVHIEVPPSEPSSLDSACEAFELNKNNDDSFIVFDAPSDANDDDPRQSECRIDN
CTESVELSIESSKNGQSNETDDSIVFEESKSKDLAKRKSELSLDLRKRKDSGKSNTKMFL
YIQMQLCQRLSLREWLKTQSTERDIHRILNIFQQIVDAVEYVHLQGLIHRDLKPSNIFFA
FDDKIKIGDFGLVTAMTEGINGVHTPCNTNEVNVFKKVHTARVGTHLYMSPEQMNGHNYN
YKVDIYSLGIILFELLIPFSTEMERVCALTNLRKSIFPDNFSLQHPAEFQLLKMMLDENP
EKRPTTLGIKARPPFLKNEIPNSLNQNENSKWHFELPQMSRHSSIANSSGSDSLENVC
NT seq 2877 nt   +upstreamnt  +downstreamnt
atgccgcgatggagcagctggccgagcatcttattgctgctgctcgcggcgaggacgtgc
gccgagatcagacagctgccgtactgcaaggacgcagtggctgccgcgccgtcccgcagc
ttgttgtacgtcagcactttagatggaaaacttacagctcttgatgcttctctcgaaggc
cagaaaaaatggtcattggattttaaaaagcagccattgctttcatctaacattcataga
agagacttgaataacaacggtcaatgggtacgcttaatcccttcgttgaatggaggcttg
tacaaatttgatggagagaatcttgaagctgtacctgtttcggtggaccagcttttgcaa
tcatcttttcgttattccgatgaccttattttttctggtggtaaagagaccaaaacttat
ggtatatcaagtacaagtgggaggatcctttatgaatgtaaaatgagtagttgcactaat
aaaactaatggagagagcttggtagaggaagacgttttaattgtacgacatcatcaacat
acagtaagagctggtgagcctaggacaggaattgaaaggtggaactttagcgtaggccaa
catgatttaactatgttgcctcgtgagaatgcagattgtcatcaagaaattccaccagtg
actttagaaatagaaatccggaccattgttcctgaaggtcttgtgatagcttacagtaaa
acaaaccctcaaatcaagttgtgggaacacaagtttgactctccagtggtagcagtttgg
agaggtgaccaggtatatgaaaatggtgctatcacaccactaaaagaagtcaatctattt
gaatcttcacaattagattccgagttagatgccgaattttccttaaatcctgggctatat
ataggtatgcatgaaagacaattgtatatacaagaaaatcccgcttttcgcagagcaatt
gatcatgctccaacggaattaattaagtatccttggaggccatatcctgctattgaattt
tctaaagatgtcggaaatgataaaagtaaagaagtaccatttgaaatgagtgaagtacta
agtaccactgcattatctgttttgtataactcagaatacataaatggaaatggattttac
ttatactcaaaagaacagattcagttggagggaggcagccaatgcaatggtacaggacca
aaaaaaaatttagtggaaacttcatcaccatctccatcaatagaatatcaagaagaagat
gatacccctgtacaagttattattgtttctctgtggtactggtggagagaagtagtgata
atatcgattactacagctattttgctaaatttcatgttgacacaaagacttttgaatgca
actgctgaaaccaaggatgctatattaccacctctaatagttgaacgacacgttgttgaa
accaaacctgaaagtctgaagagtaattcagaggacgctgacgctaactttaattcgcga
tacctgactgattatgaaccactggactgtttaggtcgtggtggttacggagtagttttt
gaagctagaaacaaaattgatgactgtaactatgcaattaaaagaatcgcgttgccaaat
agtcgatactcgagagagcgcgttatgcgcgaggtaaaagctctggccaaactggatcat
cacaatattgttcgctacttcaatgcctggcttgagtgtccaccagcaggttggcaggag
gagcacgataggcagtggtcaaatcacaaaaaatttcctaattctgattttgcatccgaa
tcttccattgcagatacttcggtacatatagaagtaccacctagcgagccgtcgtcctta
gacagtgcgtgcgaagcatttgaacttaataagaacaatgatgactcttttatagtgttc
gatgcgccgtcagacgcgaatgatgacgaccctcgccaaagtgagtgcagaatagacaac
tgtaccgaaagcgtagagctgtcaattgaaagtagcaagaatggtcagagcaatgaaaca
gacgattctattgtttttgaagaatcgaaaagcaaggatctcgcaaagaggaaatccgag
ctgagtttagatttaagaaagcgtaaagacagcggaaaatctaacacgaaaatgtttttg
tacatccaaatgcaactttgtcaaagattgagtctcagagagtggctcaagacgcaaagt
actgaacgtgatattcataggattttgaatatttttcaacaaattgttgacgcagtagaa
tatgtgcatttacagggtttgattcatcgtgacttgaagccctccaacattttctttgca
tttgatgataagataaaaatcggcgactttggacttgtaactgcaatgactgagggcatt
aacggagttcatacaccatgcaataccaatgaagtgaatgttttcaagaaggtgcatacc
gcgcgcgttggaactcacctgtacatgtctccagaacagatgaatgggcataactacaac
tacaaagtcgacatttattcccttggaataattttatttgaattgttaattccattctca
acagagatggaaagagtttgtgctctaacaaatttgagaaagtcaatttttccagataat
ttctctctgcagcaccctgcagaatttcaactattgaaaatgatgttggacgagaatccg
gaaaaacgaccaacgacgttaggaataaaggctcgtcctccattcctgaaaaatgaaatt
ccaaatagtttgaaccagaatgaaaattccaaatggcactttgaactaccgcagatgagt
aggcattcctctatagcaaatagcagtggaagcgattctttggaaaatgtttgttaa

DBGET integrated database retrieval system