KEGG   Nasonia vitripennis (jewel wasp): 100120934
Entry
100120934         CDS       T01081                                 
Name
(RefSeq) tRNA dimethylallyltransferase isoform X2
  KO
K00791  tRNA dimethylallyltransferase [EC:2.5.1.75]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
nvi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nvi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:nvi01006]
    100120934
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:nvi03016]
    100120934
Enzymes [BR:nvi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.75  tRNA dimethylallyltransferase
     100120934
Prenyltransferases [BR:nvi01006]
 Compound prenylation
  tRNA dimethylallyltransferase
   100120934
Transfer RNA biogenesis [BR:nvi03016]
 Eukaryotic type
  tRNA modification factors
   Other tRNA modification factors
    100120934
 Prokaryotic type
    100120934
SSDB
Motif
Pfam: IPPT zf-C2H2_jaz zf-met IPT zf-C2H2_2 AAA_16 AAA_33 AAA_22 SF3a60_Prp9_C AAA_18
Other DBs
NCBI-GeneID: 100120934
NCBI-ProteinID: XP_001604528
NASONIABASE: NV16690
UniProt: A0A7M7G557
Position
3
AA seq 494 aa
MAESQCQAECAIMSSRVQPILVILGATGTGKSKLGIELARRFRGEIISADSMQVYKGLDI
ITAKVTKEEQAQAQHHLLDVVDPLREFTVVEFRNRALPIIDRLVKSAKMPIIVGGTNYYI
ESLIWKVLVDNPNQGDFDSDEESPLKIRRIDGTSNEELHKKLMEVDPEMASRLHPNNRRK
VIRSLEIFEQHGTTHSEILRQQRLAGGSALGGPLRHENSIILWLTCNRDVLDRRLDARVD
SMLKADLVQELLDFHERYNKDRIQKNESADYSKGIFQSIGFKEFHNYLILPKQERDSETG
QKLLKEAIENLKIATRRYARRQHKWVRNRLIRRVDRQVPPVYSLDCTDLEQWESEVYGKA
VEIVAAVMSGETPRVKATNSSVDDTDAKVTDPSIETNHFCEVCQRVFIGEFQWTEHMTGA
KHKRVLEKKRRLEKEQYLKELEKKSEAEAEIKKDAENGSETESEAKKDAEEVLQTKSEEK
KDVQKVLEAESLTT
NT seq 1485 nt   +upstreamnt  +downstreamnt
atggcggaatcgcagtgtcaagccgagtgcgcgattatgtcgtcccgagtgcaaccgatc
ctggtgatcctgggtgccaccggcacgggtaaatccaagctgggcatcgagctggcccgt
cgctttcgcggcgagatcatctccgccgacagtatgcaggtctacaagggtctcgacatt
atcacggcgaaagtgacgaaggaggagcaagcccaggcccagcatcacttgctcgacgtc
gtcgacccgctccgcgaattcacggtggtcgaattcaggaacagggcactgccgatcatc
gatagactggtaaaaagtgcgaagatgcccatcattgtgggtggcacgaactactacatc
gagtcgctgatctggaaggtcctggttgacaatccgaatcagggcgattttgacagtgac
gaagaatcgccgctgaagattcgacgaatagacgggactagtaatgaggagttgcacaag
aaactaatggaggtcgatcccgaaatggcgtcgaggcttcatccgaacaacaggcggaaa
gtcatcaggtcgctggagattttcgagcagcacggcacaacgcactcggagatcctgaga
cagcagcgcctcgccgggggcagcgcactgggcggccctctgcgacacgaaaactcgatt
atcctctggctgacttgcaacagggacgttctggacaggagattggacgctcgagtggac
tcgatgctgaaagctgatttggtccaggaactccttgactttcacgagaggtacaacaag
gatcgcatccagaagaatgagtcagccgattactccaaaggcatcttccagagcatcggc
ttcaaggaatttcacaactacttgatacttcctaaacaggagcgggattccgagacgggc
cagaagctgctgaaagaagccattgagaatttgaaaatagccacgaggaggtacgccagg
aggcagcacaagtgggtgaggaacagactcatacgaagggtggacagacaggtgccgccc
gtctactcgctggactgtacggatctggagcaatgggaaagcgaggtttatgggaaagcg
gtcgaaatcgtggctgcggttatgagcggcgaaacgccccgtgtaaaggcgacgaacagc
tctgtcgacgacaccgatgcgaaagtcaccgatcccagtattgaaacgaaccatttctgc
gaggtgtgtcagagggtgtttatcggggagttccagtggacggaacatatgaccggtgcc
aagcataaaagagtcctggagaagaagagaagactagagaaggagcagtacctgaaggag
ctggagaaaaagtctgaagccgaggctgagattaaaaaggacgctgagaatggatccgag
actgaatccgaggcgaagaaagatgccgaggaagtgctacaaactaagtctgaggagaag
aaggacgttcaaaaagtattagaggctgagtctttgacgacgtga

DBGET integrated database retrieval system