KEGG   Nasonia vitripennis (jewel wasp): 100121021
Entry
100121021         CDS       T01081                                 
Name
(RefSeq) lysophospholipid acyltransferase 5
  KO
K13515  lysophospholipid acyltransferase 5 [EC:2.3.1.23 2.3.1.-]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
nvi00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:nvi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    100121021
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:nvi01004]
    100121021
Enzymes [BR:nvi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.23  1-acylglycerophosphocholine O-acyltransferase
     100121021
    2.3.1.-
     100121021
Lipid biosynthesis proteins [BR:nvi01004]
 Phospholipid acyltransferase
  LPAAT/LPLAT
   100121021
SSDB
Motif
Pfam: MBOAT
Other DBs
NCBI-GeneID: 100121021
NCBI-ProteinID: XP_001604606
NASONIABASE: NV10095
UniProt: A0A7M7G6K0
Position
1
AA seq 471 aa
MASVDRVPGLLGSLAELVGAPTDALRLLISILLGFPLALIHRRTLYGKSPTSQHYYFAAC
GLIIGFWNYGVDIMHSMAALTVTYLTLKALGGTLVSVILTFIFNMGYLLIGYYATATGDY
DIKWTMPQCVLTLRLIGLAYDIHDGQKKEEKLSETQKLTALREQPSFLEMAGFCYFPGSF
LIGPQFSMRRYLDYVNGKLVETELDSNGDRKPPASIWPGVQRALVGFVYVALYQIGTQYV
SDQYLLEPEFDQLGFVKRCFLLGLWGRCNLYKYISCWLITEGVCIIFGLTYNGKDKDGRD
KWDGCANVSLLTFENATEFNHYIMSFNINTNHWCAEYIYKRLKFLGSKLYSQLATLAFLA
VWHGLHSGYYLCFFQEFIIMYFEKDIKPVLTKNQKLQGLVNGNFLSRTLLWSVLKVYTFV
FMGYSLIPFVLLSYSRYMKVYKSFYFMGHVIFLSYPLIAPFIKKQLKPRRD
NT seq 1416 nt   +upstreamnt  +downstreamnt
atggccagtgtcgatcgggttcctggactcctgggaagtttggcggagctcgttggcgcg
cctacggatgcgttgcgccttctcatctccattctactaggcttcccactggcgctaatt
cacaggcgaacattgtacggaaagagtccgacgagtcagcattattatttcgcagcatgt
ggtctcattatcggcttttggaactacggtgtggatattatgcattcgatggcggcatta
accgtcacctacttgaccctcaaagctcttggcggcacgctcgtttccgtcattctgacg
tttatatttaacatgggttatttgctcattggttattacgcgacggcgactggagattac
gatataaaatggaccatgccccagtgcgtcttgactttgagactgataggtctcgcctat
gacatacacgacggtcaaaagaaagaggaaaaattatcggagacgcagaagctcactgct
ctgcgggagcagccgtcttttctcgagatggcaggcttctgttatttccctggatcgttc
ttgattggaccccaatttagcatgagaagatacctggattacgtgaatggcaagctcgta
gagacggaattggatagcaacggcgacaggaaaccacccgcttctatttggcctggagta
cagcgagcgttggtagggttcgtttatgtggcgttgtatcaaatcggcacgcaatatgtc
tcggatcagtaccttcttgaaccggaattcgatcagttgggattcgtcaaacggtgcttc
ctcctgggtctctggggaagatgcaatctttacaaatacattagttgctggctcatcacc
gaaggagtttgcatcatttttggtctgacgtacaatggaaaagacaaggacggccgcgac
aaatgggacggttgcgctaacgtcagtcttttgactttcgaaaatgccacggaattcaac
cattacattatgtcgttcaacatcaacacaaaccactggtgcgcggaatacatttacaag
agattgaaattccttggctcaaagctctacagtcaactggccaccttggcattcctcgcc
gtgtggcatggattgcacagcggatactatctttgcttcttccaagaatttattatcatg
tacttcgagaaagacatcaagcctgtactgactaaaaaccaaaagcttcaagggctcgtg
aatggaaactttttgtccaggacgttattgtggtcagtcctcaaagtttacacgttcgtt
ttcatgggatacagtctcataccgtttgttctgctatcatactcgcgctacatgaaggtt
tacaagagcttctactttatgggccacgtgatctttctctcgtatccactgattgcgcct
ttcataaagaaacagttaaaaccgcgaagagactaa

DBGET integrated database retrieval system