KEGG   Nasonia vitripennis (jewel wasp): 100121081
Entry
100121081         CDS       T01081                                 
Name
(RefSeq) vesicle-associated membrane protein 2 isoform X2
  KO
K13504  vesicle-associated membrane protein 2
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
nvi04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:nvi00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    100121081
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:nvi04131]
    100121081
Membrane trafficking [BR:nvi04131]
 SNARE
  VAMP, Ykt6, Sec22 (R)
   VAMP
    100121081
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Rab associated proteins
    100121081
SSDB
Motif
Pfam: Synaptobrevin MCU DUF4407 CD34_antigen DUF4199 MBDa Phage_Mu_Gam Fzo_mitofusin ERM_helical CelTOS
Other DBs
NCBI-GeneID: 100121081
NCBI-ProteinID: XP_001604664
NASONIABASE: NV16941
UniProt: A0A7M7GEM0
Position
2
AA seq 130 aa
MATEGGLAPDAAGGAAPGAPGADGIVGGPRTPQQVAAQKRLQQTQAQVDEVVDIMKTNVE
KVLERDQKLSELDDRADALQQGASQFEQQAGKLKRKFWLQNLKMMIIMGVIGLIVLAIIV
ACYTGGSDSE
NT seq 393 nt   +upstreamnt  +downstreamnt
atggcaaccgagggcggacttgcccctgatgcggccggtggcgcggctccgggcgccccg
ggagccgacggcatcgtcggcggcccgaggacgcctcagcaggtcgccgcccagaagcgg
ttgcagcaaacgcaggcccaagtcgacgaggtcgtcgacatcatgaagacgaacgtcgag
aaggtcctggagcgtgatcagaagctctcagaactcgacgatcgagctgatgcactccag
caaggtgcgtcacagttcgaacagcaagctggaaagctaaagaggaagttctggctacaa
aacttgaagatgatgataattatgggtgtcatcggactaatcgtgctggccatcattgtc
gcgtgctacaccgggggaagcgactcggaataa

DBGET integrated database retrieval system