KEGG   Nasonia vitripennis (jewel wasp): 100121130
Entry
100121130         CDS       T01081                                 

Definition
(RefSeq) DNA-binding protein RFX2 isoform X5
  KO
K09173  regulatory factor X 1/2/3
Organism
nvi  Nasonia vitripennis (jewel wasp)
Brite
KEGG Orthology (KO) [BR:nvi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:nvi03000]
    100121130
Transcription factors [BR:nvi03000]
 Eukaryotic type
  Other basic domains
   RF-X
    100121130
SSDB
Motif
Pfam: RFX_DNA_binding SoxE DUF2258 Pox_D5 HisKA
Other DBs
NCBI-GeneID: 100121130
NCBI-ProteinID: XP_008209223
NASONIABASE: NV16418
Position
1
AA seq 908 aa
MSISWQTSTSSTDSAASLELLGIFDNEEIIVVPSRDDSSVDDGNNPESDDSYLFLENGDF
IDYEPSLQKRRGRSGGNTPCQERGEGVIAMTTTGAQYALAASTGAGNGGGNSAVGVEKPS
VVVVTTSNSNGSGSAAQSQSGRGQQLITVVTSGDPSSPNSLQPIQLLVQDPLDNTADSSN
GSSGTQAHVTAQVVVNTTHSGQHTLVDSDTASTSAGTIVSGSPHYITVTVPGDADAVGSE
SVTHPTYVQYVEGDGSTYIPTNGQIDSFFRTYPVYAVGEAGTMYTPASNQYYTSTSTPVT
YAQVTGSSTTTGQLLSQGNGTYLIQQSVVDTDPATHALISAAAAARASPQTESAEAVVSG
GGGAYLISGNSTTATAPVSVEDAATAAANMTHATRVSQATVSHNDSPFVQWLLENYETAD
GVSLPRSTLYNHYLRHCSDNKLDPVNAASFGKLIRSVFLGLRTRRLGTRGNSKYHYYGIR
VKPSSPLVLLNEDGTSRQQATSNIQANNNKRVKFVNQKQTETTYETTNTQTNNNNNSNIS
SNASPPQYHQYLGEASCAIPEFPEIVVGHGSSLPEDCTLEDVDTFRSIYREHCEAFLDAV
LNFEFATIESLWREFWRSQDNNNGDECEEEKYLSKTKLYQMCKCIEVQGFIKKVDYTFYQ
NLVEVLMPDVLRPIPSPLTQSIRNFAKGLESWLTSAMNDCPEEMMQIKLSAVSAFAQTLR
RYTSLNHLAQAARAVLQNNSQINQMLADLNRVDFHNVQEQASWVCQCDYSVVQRLEADFK
VTLQQQNSLEQWAVWLKSVVTQVLQPYEGKPTFAKAARQFLLKWSFYSSMVIRDLTLRSA
ASFGSFHLIRLLYDEYMFYLIEHQVAVSTGTTPIAVMGDKSQNYSMVNVFGANGDTSNIC
PAKRVKLS
NT seq 2727 nt   +upstreamnt  +downstreamnt
atgagcatcagctggcagacgtcgacgagctcgacagacagcgcagcctcgttggagcta
ttgggaatcttcgacaacgaagagataatagtcgtgccgtcgcgcgatgacagttccgtc
gatgatggcaataatccggagtccgacgactcctacctcttcctcgaaaatggagatttc
atcgattacgagccatccctgcagaaacggagaggtcgaagtggcggtaatacgccttgt
caagagagaggtgagggagttattgccatgactacaacaggagcccagtacgctctcgca
gcatccaccggagctggcaatggtgggggcaactccgcagtgggagttgagaagcctagt
gtcgtcgttgttaccacttctaattccaatggcagtggcagtgctgcccagtcacagtct
ggtagaggtcagcagttaatcacagtggtcaccagtggcgatccttctagtcctaacagt
ttgcaacccattcagctattggtacaagatccattggataatacagcagactcttcaaac
ggatcatcaggcacacaagcacatgtaacagcacaagttgttgttaatacaacgcattct
ggtcagcacactcttgtagactctgacacggcatcaacatcagcagggacaattgtcagt
ggctcacctcactatatcactgtaacagtacctggagacgctgacgccgtggggtccgaa
tcagtaactcatcccacctacgtgcaatatgtcgagggcgatggatccacgtatataccg
acaaatggacagattgattcttttttcaggacatatccggtgtatgctgttggagaggcg
ggaacaatgtacactcccgcctccaaccagtattatacttccacttccacaccggtgact
tatgctcaagtcaccggctcaagcacaactacaggtcagctactgtcgcaaggcaatgga
acctacttgatacagcagagcgtcgtagacacagaccctgcaacacacgctcttatatca
gccgctgcggcagctcgcgcgagcccgcagacggaaagcgcagaggctgttgttagcggg
ggtggcggggcatacttgatcagcggtaattcgacgacagcaactgctccagtcagcgtg
gaagacgctgctactgcagcagctaacatgacgcatgcgactagggtctcccaggccacc
gtaagccataacgactccccgtttgtacaatggctgttggaaaactacgaaactgccgat
ggagtatctctacccagatcgacgttgtataaccattaccttcggcattgttcggataat
aaattagatcccgttaacgcagctagtttcggaaagctgattaggtccgtgtttttgggc
ttgcgtacgcgacgtctcggaactcgggggaattcaaaatatcattactatggtatccga
gtgaaaccaagctcgcctctggtgttactgaatgaggatggcacgtcgcgacaacaggca
acttcaaacatccaagcaaacaacaataagcgtgtcaaatttgtcaatcagaagcaaaca
gagacaacgtatgaaacgacaaacacacagactaacaacaataataacagtaacatctct
tcaaatgcatcgccaccccaataccatcagtaccttggtgaggcgagttgcgccataccc
gagtttccagagatagtcgttggtcacggttcatcgttgcctgaagattgcactttggaa
gacgttgatacgttccgtagtatctaccgagagcactgtgaggcttttcttgacgctgtt
ctcaactttgagttcgccactattgaaagtctttggcgcgaattctggcgtagtcaggat
aataacaacggcgatgaatgcgaggaggagaagtatctatccaaaaccaagctttaccaa
atgtgcaaatgcatcgaagttcaaggcttcattaagaaagttgattatactttttatcag
aacttggtggaagtactgatgcccgacgttctaaggcctatacctagtcctttaacccaa
tctatacgaaattttgccaaaggcttggaatcatggttaacttcggcgatgaatgattgc
cccgaagaaatgatgcagattaagttgtcggctgtatcagcgttcgctcaaacactaaga
agatatacctctttgaatcacttggctcaagctgccagggctgtgcttcagaacaatagt
caaatcaatcaaatgttggcagatttaaatcgagtcgattttcataacgttcaggagcag
gcttcctgggtttgtcaatgcgattactcagtggttcaacggttagaagcagacttcaaa
gtaactttgcagcaacaaaattcgttagaacagtgggctgtttggttgaaaagcgttgtg
acacaagtactacagccttatgagggcaaacctacttttgccaaagcagcacgacagttc
ctgctcaagtggtctttttatagttcgatggttataagagatttaaccctaagaagtgcc
gctagttttgggtcctttcatcttattcgtttgctttacgatgagtacatgttttattta
attgagcatcaagtggcggtttccacgggtacaacgccgattgccgtaatgggagataaa
agtcaaaactattcaatggtgaacgtttttggagctaatggagatacatcaaatatttgt
ccagcaaaacgtgtcaagttgagctaa

DBGET integrated database retrieval system