KEGG   Nasonia vitripennis (jewel wasp): 100121208
Entry
100121208         CDS       T01081                                 
Symbol
Atp5l
Name
(RefSeq) ATP synthase subunit g, mitochondrial
  KO
K02140  F-type H+-transporting ATPase subunit g
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
nvi00190  Oxidative phosphorylation
nvi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nvi00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    100121208 (Atp5l)
SSDB
Motif
Pfam: ATP-synt_G
Other DBs
NCBI-GeneID: 100121208
NCBI-ProteinID: NP_001165821
NASONIABASE: NV13434
UniProt: A0A7M6UFT7
Position
2
AA seq 99 aa
MAKLVGSLTGLVQNTLKSAAPQLKIIQRYAMVELTPPSPKDIPAIRSGISKLMHSAKTGS
YKNLTVKEAWLNTLVAVEVYCWFFIGECIGKRHIVGYDV
NT seq 300 nt   +upstreamnt  +downstreamnt
atggcaaaattggttgggtctcttaccggccttgtgcaaaacacgctcaagtcagctgcg
ccacagctcaaaatcattcagcgatatgctatggtcgaattgacacctccgtctccaaag
gacatccctgctattcgctctggaatttccaaactgatgcacagtgccaagaccggatca
tacaagaaccttacagttaaagaagcctggttaaataccttggttgccgttgaagtttac
tgctggttcttcataggtgaatgcattggcaagcgacacattgttggttatgatgtttaa

DBGET integrated database retrieval system