KEGG   Nasonia vitripennis (jewel wasp): 100121755Help
Entry
100121755         CDS       T01081                                 

Definition
(RefSeq) soluble guanylate cyclase 88E
  KO
K01769  guanylate cyclase, other [EC:4.6.1.2]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
nvi00230  Purine metabolism
nvi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nvi00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100121755
Enzymes [BR:nvi01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     100121755
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HNOBA Guanylate_cyc HNOB
Motif
Other DBs
NCBI-GeneID: 100121755
NCBI-ProteinID: XP_008206359
NASONIABASE: NV15627
UniProt: K7J2P7
Position
3
AA seq 869 aa AA seqDB search
MYGLILENMAEYIRQVYGEDRWEEIRRQAAVEQPSFSVHQVYPENLIPRLAKKAIQVLGI
TEREFFDQMGVHFVSFVGQYGYDRVLSVLGRHVRDFLNGLDNLHEYLKFSYPRMRAPSFI
CENETRQGLTLHYRSKRRGFVYYTMGQIREVARHFYHKELKIELVREEILFDTVHVTFQL
TFDNRAFTLASLAMTREEKHLPIGASVLFEIFPFCIVFGSDMIVRSIGNSLMVILPDLIG
KKITHRFDLVRPLIAFKFQSILNRTNNIFELVSVEPVLAERPSERRKNDLLLSHEIDSQE
DRTLRLKGQMIYMDNWKMMMYLGTPVMPDLHALVGAGLYINDLSLHDFSRDLMLAGTQQS
VELKLALDQEQLKSKKLEESMRKLDEEMKRTDELLYQMIPKQVADRLRNGESPIDTCEMF
DSVSILFSDVVTFTEICSRITPMEVVSMLNGMYSLFDTLTERNHVYKVETIGDAYMVVSG
APVKQNDHAERVCDMALDMLEAITDLTDRSTGQHLQIRIGIHSGAVVAGIVGLKMPRYCL
FGDSVNTASRMEATSGAMQIHISQSTKELLSAAYKVTERGEIQVKGKGTMKTYWLEKREY
RSLQSTKNISIQEPHQWHSSPGQQLSSSPSGAAARLVARMPSSPSLPYPGQQQPIPIGPP
TGVSASSSGLLYAEERPIYSPITFQDVARRSVANSPTKSLPVKELRSNSLGAVSTSSFQN
PTADLLGSLISDTEQHFRLHRDSGSSPRHSKPQQQQHQQQQQSAAVHTSSIHPDPHNHHH
HHGYHHQLLLTTTTTTTTTTTTTTSSGNCSASSSAEGEDKHFLGSGSDSSHSQLQRMRAE
QPCCPGFAIPKAGGPGGKSKSQNAGCTIN
NT seq 2610 nt NT seq  +upstreamnt  +downstreamnt
atgtacggcctcatcctggagaacatggccgagtacatccggcaggtgtacggcgaggac
cgctgggaggagatccgccgacaggccgcggtcgagcagcccagcttcagcgtgcaccag
gtctacccggagaacctcattccccggctcgccaagaaggccattcaggtcctgggcatc
acggagcgcgagttcttcgaccagatgggcgtgcactttgtcagcttcgtcgggcagtac
ggctacgaccgggtgctctcggtgctgggccggcacgtgcgcgacttcctcaacgggctg
gacaacctgcacgagtacctcaagttctcctacccgcgcatgagggcgccctcgttcatc
tgcgagaacgagactaggcaaggactgactctgcattacagaagcaaacgccggggcttc
gtctactacacgatgggccagatccgggaggtggcccggcacttttaccacaaggagctc
aagatcgagctcgtccgcgaggagatactcttcgacacggtccacgtgaccttccagctg
accttcgacaaccgggcgttcaccctcgcctcgctggccatgacgcgcgaggagaagcac
ctgccgatcggcgcctcggtcctcttcgagatctttccgttctgcatcgtcttcggctcc
gacatgatcgtcaggagcatcggcaactcgctcatggtcatcctgccggacctcatcggc
aagaagatcacccaccggttcgacctcgtcaggccgctcatagcgttcaagttccagtcg
atcctcaaccggaccaacaacatcttcgagctggtctccgtggagccggtgctcgccgag
cggccgagcgagcggcgcaagaacgacctgctgctcagccacgagatcgactcgcaggag
gaccgcaccctccggctcaagggccagatgatctacatggacaactggaagatgatgatg
tacctcggcacgccggtcatgcccgacctgcacgccctcgtcggcgccgggctctacatc
aacgacctctcgctccacgacttcagcagggacctcatgctcgccgggacgcagcagtcg
gtcgagctgaagctggccctcgaccaggagcagctcaagagcaagaagctcgaggagtcg
atgcgcaagctcgacgaggagatgaagcgcaccgacgagctgctctaccagatgataccg
aagcaggtggccgaccggctccggaacggcgagagcccgatcgacacgtgcgagatgttc
gacagcgtctcgatcctcttctccgacgtggtcaccttcaccgagatctgcagtcgcatc
acccccatggaggtcgtctcgatgctcaacggaatgtactcgctcttcgacactctcacg
gagcgaaaccacgtgtacaaggtcgagacgatcggcgacgcgtacatggtggtgtcgggg
gcgccggtcaagcagaacgaccacgccgagcgggtctgcgacatggcgctggacatgctc
gaggccataaccgacctgacggaccgctcgaccggccagcacctgcagatccgcatcggc
atccacagcggggccgtggtcgccgggatcgtcggcctcaagatgccccgctactgcctc
ttcggcgactcggtcaacacggcctcgcgcatggaggcgaccagcggggccatgcagatc
cacatctcccagtcgaccaaggagctgctctcggccgcctacaaggtcaccgagcgcggc
gagatacaggtcaagggcaagggcaccatgaagacctactggctggagaagcgcgagtac
cgctcgctccagtcgaccaagaacatctcgatccaggagccgcaccagtggcacagctcg
cccggccagcagctatcatcctcgccgagcggcgccgcggcgcgactcgtcgccaggatg
ccctcctcgccgagcctgccctacccgggccagcagcagcccataccgatcggcccgccg
accggcgtctcggcatccagctccggcctcctctacgccgaggagcgacccatctactcg
cccatcaccttccaggacgtcgcccggcgctcggtcgccaactcgcccaccaagagtctg
cccgtgaaagagctgcgctccaactcgctgggcgccgtctcgacgagctccttccagaac
ccgacggccgacctgctgggctcgctcatctccgacacggagcagcactttcggctgcac
cgggacagcggttcctcgccccggcactcgaagccgcagcagcagcagcaccagcagcag
cagcagtccgccgcggtgcacacctcctccatccatcccgacccgcacaaccaccaccac
caccacggctaccaccaccagctgctcctgacgacgacgaccacgaccacgaccacgacc
acgaccacgacctcctccggcaactgctccgccagcagcagcgccgagggggaggacaag
cacttcctcggcagcggcagcgacagcagccactcgcagctccagcggatgcgcgccgag
cagccctgctgtccgggcttcgccatccccaaggccggcggccccggcggcaagtccaag
agccagaacgccggctgcaccatcaactga

DBGET integrated database retrieval system