KEGG   Nasonia vitripennis (jewel wasp): 100121764
Entry
100121764         CDS       T01081                                 
Name
(RefSeq) ubiquitin fusion degradation protein 1 homolog
  KO
K14016  ubiquitin fusion degradation protein 1
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
nvi04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:nvi00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100121764
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:nvi03009]
    100121764
Ribosome biogenesis [BR:nvi03009]
 Eukaryotic type
  Pre-60S particles
   Ribosome quality control proteins
    100121764
SSDB
Motif
Pfam: UFD1
Other DBs
NCBI-GeneID: 100121764
NCBI-ProteinID: XP_001605370
NASONIABASE: NV11633
UniProt: A0A7M7G7C0
Position
2
AA seq 294 aa
MFRLFPEIPRPFNTQYKCFSVSMLPGNERQDVERGGKIIMPPSALDTLTRLNIVYPMLFK
LTNKKTNRITHCGVLEFVADEGKVYLPYWMMHNLLLQEGEILNVECVSLPVATYARFQPQ
SEDFLDITNPKAVLENGLRNFACLTTGDVIAIKYNARIYEMCVLETKPGSAVTIIECDMN
VEFAPPVGYKEPEKPVSKEEDNVDPVDLMPEPTGFVAFKGQGNRLDGKKRKESAPTETAS
DKPVYVRGIPDYDYKIGTLKFLRNVKPVNVKEVKDQDEFKAFMGEGFSLRKSKK
NT seq 885 nt   +upstreamnt  +downstreamnt
atgtttcgactatttcccgagatacctcgtcccttcaatactcaatacaaatgcttctca
gtgtctatgttacctggcaatgaacgacaagatgttgaacgaggtggaaagattattatg
cctccttcagcacttgacactctcacaagactgaacattgtttatccaatgttatttaaa
ctgacaaataagaagactaacagaataactcactgtggagtacttgaatttgttgctgac
gaaggaaaagtttaccttccttattggatgatgcacaatctgcttctgcaagaaggggaa
atcttaaatgttgagtgtgtctcgctaccagtagctacctatgcgcgttttcaacctcaa
tcagaagattttttagatattacaaatcctaaggctgtgttagaaaatggattaagaaat
tttgcctgtctaaccacaggtgatgttatagctatcaagtacaatgcacgtatttacgaa
atgtgtgtactagagactaaaccaggttcagctgttactattattgagtgtgacatgaat
gttgagtttgctcctcccgttggttacaaagagcctgagaagcctgtatcaaaagaagag
gacaatgtcgatcctgtagatttaatgccagaaccaactggatttgttgcttttaaaggg
caaggaaacagattggatggcaaaaagaggaaagaatctgcacccacagagactgcatcg
gacaaaccggtttatgtcagaggcataccggattatgattataagataggcactttaaaa
tttttacgcaatgtgaagccagtaaatgtcaaagaggtgaaagatcaggatgaattcaaa
gcgtttatgggagaaggattttccttacgcaagtcgaaaaagtga

DBGET integrated database retrieval system