KEGG   Nasonia vitripennis (jewel wasp): 100121765Help
Entry
100121765         CDS       T01081                                 

Definition
(RefSeq) GTP cyclohydrolase 1
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
nvi00790  Folate biosynthesis
nvi01100  Metabolic pathways
Module
nvi_M00842  Tetrahydrobiopterin biosynthesis, GTP => BH4
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    100121765
Enzymes [BR:nvi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     100121765
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-GeneID: 100121765
NCBI-ProteinID: XP_001605371
NASONIABASE: NV11948
Position
3
AA seq 232 aa AA seqDB search
MKTEKSENGQQNGAENGCQNGNCRSGHEKCTFHHDMELDHRPPTREALLPQMSHSYKLLL
QALGENTERQGLLKTPERAAKAMLFFTKGYDQSLEDVLNDAIFDEDHDEMVLVKDIEMFS
MCEHHLVPFYGKVSIGYLPCKKILGLSKLARIVEIYSRRVQVQERLTKQIAEAVTKAIAP
AGVAVVVEGVHMCMVMRGVQKINSKTITSTMLGVFRDDPKTREEFLNLVRAK
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccgagaagagcgaaaacggacagcagaacggagccgagaacggatgtcagaat
ggcaactgtcgttcaggtcacgagaagtgcacgttccatcacgacatggaactggaccat
aggccaccgacccgcgaggctctgctgccccagatgtcccacagttacaagctcctgttg
caggcgctcggcgagaacaccgagagacagggtctgctcaagacgcccgagagggctgcc
aaggctatgctgttcttcaccaagggctacgatcagagtctcgaggatgtcttgaacgac
gccatattcgacgaggatcatgacgagatggtcctcgtgaaggacatcgagatgttttcc
atgtgcgagcaccacctcgtgccgttctacggtaaggtctccatcggctacttgccctgc
aagaagatcctgggactgagcaaacttgcaagaatcgtcgagatatacagcagacgagtg
caggtacaggaacgtctgacgaagcagatcgccgaggctgtgaccaaagctatcgcgccg
gctggtgttgccgtggtcgtcgaaggagtgcacatgtgcatggtcatgcgaggcgtacag
aagatcaacagcaagacgatcacctcgactatgctcggcgttttccgcgacgatcccaag
acccgcgaggagttcctcaacctcgtgcgtgcgaagtaa

DBGET integrated database retrieval system