KEGG   Nasonia vitripennis (jewel wasp): 100121839Help
Entry
100121839         CDS       T01081                                 

Definition
(RefSeq) nitrilase homolog 1
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Brite
KEGG Orthology (KO) [BR:nvi00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    100121839
Enzymes [BR:nvi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     100121839
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-GeneID: 100121839
NCBI-ProteinID: XP_008216975
NASONIABASE: NV13335
Position
1
AA seq 315 aa AA seqDB search
MIRACSKVSFKLCENLNPKISKLQISTMSNPLVAVCQMTSTSDKEKNFEAVSNLVAEAKR
RNACIAFLPEACDYLADNKADSVSMAESLDGSIVQRYKELALKEDMWLSLGGVHEAVCFK
PKLPEKGKTQNAHIIINNKGELVSIYRKIHLFDMENKETGVRLMESDYVLKGSKIVPPVA
SPAGKIGLSICYDMRFPELSLCLRNMGAQILTFPSAFTYQTGAAHWEVLLRARAIETQCY
VIAAAQVGTHNKKRVSWGHAMIVDPWGTVVAQCMEKQGVAVAEIDLDIVNKVRRNMPNEQ
HRRTDLYPAMLSLDG
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgattcgagcatgttcgaaggtgtcttttaaattgtgtgaaaacctcaacccaaaaata
tcaaagctacagataagcacaatgtcaaatccacttgttgctgtctgtcaaatgacatct
acatcggacaaggaaaaaaactttgaggctgtcagcaatttagttgcagaggccaaacga
agaaatgcttgtattgcatttttacctgaagcatgtgattatctagctgataataaggct
gattctgtgtcaatggccgaatctttggatggctccatagtgcaacgttacaaggaactt
gctttaaaagaagacatgtggctttctcttggtggggttcacgaagctgtatgttttaaa
ccgaaacttccagagaaaggaaaaacccaaaatgctcatatcataatcaacaataaggga
gagctagtttccatttacagaaagatacacttatttgacatggagaataaagaaacgggt
gtcagactaatggagtctgactatgttctaaagggtagtaaaattgttccaccagtagca
tctccagcaggaaaaattggcttgagtatttgctatgacatgcggtttccagaattatca
ttatgtcttcggaatatgggtgcacaaattctgacattcccttctgctttcacatatcaa
acgggagcagctcattgggaagtcttgttaagagcaagagctattgaaactcagtgctat
gttattgcagctgctcaagttggaacccacaataaaaaaagagttagctggggtcatgca
atgatagttgatccatggggaactgttgttgctcaatgtatggaaaaacaaggtgttgca
gtagctgagattgacttggacattgtaaataaagtgaggagaaatatgccgaatgaacaa
catagacgaactgatttgtatccagcaatgttatcattggatggttaa

DBGET integrated database retrieval system