KEGG   Nasonia vitripennis (jewel wasp): 100121840
Entry
100121840         CDS       T01081                                 

Definition
(RefSeq) DNA-directed RNA polymerase I subunit RPA2
Organism
nvi  Nasonia vitripennis (jewel wasp)
SSDB
Motif
Pfam: RNA_pol_Rpb2_6 RNA_pol_Rpb2_1 RNA_pol_Rpb2_3 RNA_pol_Rpb2_7 RNA_pol_Rpa2_4 RNA_pol_Rpb2_2 DUF1496 zf-Sec23_Sec24
Other DBs
NCBI-GeneID: 100121840
NCBI-ProteinID: XP_001606574
NASONIABASE: NV13457
Position
2
AA seq 1122 aa
MLIEPKLTNTAPDFGQPAAKQNPLLQRLGAPHIDSFNYALGQGLTEAIDNLLPVYLTLAS
GDRIELRIEDVTINHPTVPSGTIGVKNHKIYPTECRQRAATYKGKINAKIGWSINGRKQE
TVERSLGEVPIMVKSNKCHLNNMKPAQLVAVKEHEQEWGGYFIIKGHERLIRMLLMTRRN
YPIAIKRSGWKQRGDQFSDLGILLRCVRDDNTATNNSLHYVTDGSAKLMFTHRKVLYYVP
LILMLKCLMNVSDKYIYNALTAGCDDDVYYKNCVLNMMRTVHEKDLHSHEQCKAYIGKMF
RIKFYELPVNATDIEVCDFIIKYCIAIHLDDPADKFHLLCFMTKKLFALADNKCAVEGAD
AVMVQECLLGGHLYLQVIKEKLYSWLMGLRSVIVRRAKNVGNNFTLNVQEMLNALKSCGT
FDSQMENFLATGNVRSQTGLGLMQSTGLSIVAENINRMRYMSHFRAIHRGSFFQEMRTTE
ARQLLPDAWGFICPVHTPDGAPCGLLNHLTMNCIVTKHPDPKLKNAIPTILLDLGMLPMS
IADDWKNSYTVVLDGRVIGLIEDNIVGRVVDKLRVLKINEKVPPTMEIVLVPKKNVPSQY
PGVFLFTGPTRMMRPVKNLSVNKTELIGTFEQVYLNICVTAEEADEGLTTHQELSKTTFL
SNLACLIPMPDCNQSPRNMYQCQMGKQTMGTPCLTWQQQAETKLYRLQTPSTPLFRPVHH
DNINLDEFAMGTNAIVAVISYTGYDMEDAMIINKSAYERGFAHGMIYKSEFIELKEQSDY
FARDPNRADLVDKLDSDGLPNPGTILQEGDPYYSYYQVDHKTFLIGKYKGKEAAFVDNIK
LCGSLQSSTKGKVCITLRISRNPSVGDKFASRAGQKGICSQKWPAEDLPFTETGLIPDIV
FNPHGFPSRMTIAMMIEVMAGKSGAVHGLVHDATPFRFSENDTAVEYFGKLLEQGGYNYY
GTERIYSGIDGREMTADIFFGVVHYQRLRHMVSDKWQVRSTGPIDVLTRQPIKGRRRGGG
VRFGEMERDSLISHGCSFLLQDRLFHCSDKTTTLVCKKCGTLLGPVMELAINKAGPGERR
MRCRLCGDDGVLGEVDVPYIFRYLVTQLASCNINVKIAFNQK
NT seq 3369 nt   +upstreamnt  +downstreamnt
atgttgatagaaccgaagttgacaaatacggcgccggatttcggtcaaccggctgctaaa
cagaaccctcttctacaaagattaggagctccgcacatcgattcgttcaattatgcattg
ggtcaaggtctcacagaggcgatagacaatttgcttccggtgtatctgacacttgctagc
ggagataggatagaattgaggattgaagatgttaccatcaaccacccaaccgttcccagt
gggacaatcggtgttaagaatcacaaaatatatcctaccgagtgtcgacaaagagctgct
acttataagggtaagatcaatgctaagattggctggtccatcaatggaagaaagcaagag
acagtggagagaagcttgggagaagtacctattatggtcaaatccaataagtgtcatttg
aacaatatgaaaccagcacaattggttgctgttaaagaacatgaacaggaatggggtgga
tactttattattaaaggacatgaacgtcttataagaatgctacttatgactaggagaaat
tatcctattgctattaaaagatctggttggaaacaaagaggtgatcaattcagtgatttg
ggtattttgctgagatgtgtcagggatgacaatacagcaacaaacaattctttgcactat
gtaacagatggctcagccaaactgatgttcacacacagaaaagtactttattatgtgcct
ttaattttaatgctaaagtgtttgatgaatgtttctgacaagtacatttacaatgcatta
actgctggttgtgatgatgatgtgtactacaaaaattgtgtcttgaatatgatgagaact
gttcatgaaaaggatttgcattcgcacgagcagtgcaaagcatatattggaaaaatgttt
aggataaaattttatgaacttcctgtcaatgccacggatatagaagtttgcgatttcata
attaagtactgtatagcgattcatcttgatgatcctgcagataagtttcatttactttgt
tttatgacaaagaaactttttgcactagctgataacaaatgtgctgtagaaggtgctgat
gctgttatggttcaagaatgtttgctgggtggtcatttatatttacaagttatcaaagag
aaattgtattcatggcttatgggtttgagatcggtcattgtaagaagagcaaagaatgtg
ggaaataacttcacattgaacgttcaggaaatgttgaatgcactgaaaagctgtggtact
tttgactcccaaatggagaacttcttagccactggtaatgtaagatcacaaactggctta
ggtcttatgcaaagtacaggtttatctatagttgccgaaaatatcaatcgaatgcgttat
atgagtcactttagagcgatacacagaggttctttttttcaagaaatgagaactactgaa
gctaggcagttgctaccagatgcttggggtttcatttgtcctgtacatacacctgatggt
gctccatgtggtcttctcaatcacttaacaatgaactgcattgtaacaaagcatccagat
cccaaattaaaaaatgccataccaaccattctactggatttgggaatgttacctatgtca
attgccgatgactggaaaaactcttatacagttgtcttagacggccgtgtaataggttta
attgaagacaacattgttggcagagtagtggacaaattgcgggttttaaaaataaatgaa
aaagtgccaccaacgatggaaatagttttggtgccaaagaaaaacgtgccatctcagtat
cccggtgttttcctttttacggggcctacacgtatgatgagacccgtgaagaacttgtct
gtgaataagacggaacttataggcacctttgaacaagtttatttaaatatttgcgtcacc
gcagaggaagctgacgaaggactgactacccatcaagagctttctaaaacgacctttctc
agcaatttagcctgtcttattccaatgccagactgcaaccaaagtcctcgaaatatgtac
caatgtcagatgggtaagcaaactatgggtactccctgtctaacttggcaacagcaagca
gaaacaaaattgtacagactacaaacgccatcgacgcctcttttccgaccggtgcatcac
gacaacattaatcttgacgaattcgccatgggcacaaacgcaattgtcgctgttatttct
tatactggctatgacatggaagatgctatgatcatcaacaagtcagcttatgaacgaggt
tttgctcacggtatgatatataagtcggagttcatagaattgaaagaacaaagcgactac
tttgctagagatcccaatagagctgacctagttgataaattggatagtgacggtttacca
aatccgggtacaatcctgcaagaaggagatccctactacagttattatcaagtagatcac
aaaacattcctaataggaaaatacaagggaaaagaggcggctttcgtagacaacataaag
ctttgtggatctttacaaagtagcactaagggtaaagtgtgcataactttacgtatttct
cgtaatccgagtgtcggtgacaaatttgcctctcgagcaggtcaaaagggtatttgttcg
caaaagtggccagcagaagatctgccgttcacagagactggtctcatcccagatatcgtg
ttcaatcctcacggttttcccagtcggatgacaattgctatgatgatcgaagttatggct
ggaaagtcgggtgcggttcatggtttggtacacgatgcgactccgtttaggttttctgaa
aatgacactgcggttgagtatttcggaaagctgctggagcaaggtggttataattattat
gggacagaaagaatttattccggcatagacgggcgcgagatgacggctgatatatttttt
ggtgtggtacattaccaaagactgcgtcacatggtttccgataagtggcaggtgagaagc
acaggaccgatagacgttctgaccaggcaacctattaagggtagacgcagaggtggtggt
gttaggtttggtgagatggaacgtgactctttaatatcacacggatgctctttcttactt
caagatcgactatttcactgttctgacaaaacaacgacacttgtatgtaagaaatgcggt
actttacttggacctgttatggaattagcaataaacaaagctggccctggagaaagaaga
atgaggtgtagattatgcggggatgacggagtactaggcgaagtcgatgtaccatatatc
ttcagatatctggtaactcaacttgcatcttgtaatattaatgtaaaaattgcctttaat
cagaaatga

DBGET integrated database retrieval system