KEGG   Nasonia vitripennis (jewel wasp): 100122074
Entry
100122074         CDS       T01081                                 
Name
(RefSeq) geranylgeranyl pyrophosphate synthase
  KO
K00804  geranylgeranyl diphosphate synthase, type III [EC:2.5.1.1 2.5.1.10 2.5.1.29]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
nvi00900  Terpenoid backbone biosynthesis
nvi01100  Metabolic pathways
Module
nvi_M00367  C10-C20 isoprenoid biosynthesis, non-plant eukaryotes
Brite
KEGG Orthology (KO) [BR:nvi00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    100122074
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:nvi01006]
    100122074
Enzymes [BR:nvi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     100122074
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     100122074
    2.5.1.29  geranylgeranyl diphosphate synthase
     100122074
Prenyltransferases [BR:nvi01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   100122074
SSDB
Motif
Pfam: polyprenyl_synt
Other DBs
NCBI-GeneID: 100122074
NCBI-ProteinID: XP_001605679
NASONIABASE: NV16498
UniProt: A0A7M7GAR2
Position
4
AA seq 314 aa
MDSEKNGVPYSQSGDKEQDEKLLQPFTYILQVPGKQIRGKLAHAFNYWLKIPVEKLQAVG
DITQMLHNSSLLIDDIQDNSILRRGIPVAHSIYGVASTINAANYVLFIALERVISLNHPE
ATQVYTEQLLELHRGQGMEIYWRDNFICPSEAEYRTMTIRKTGGLFNLAVRLMQLFSDCK
EDFTPLAGILGLYFQIRDDYCNLCLQEYTENKSYCEDLSEGKFSFPIIHAIQSNADDGQV
LNILRQRTKNVEVKRYCVNLLDKFGSFAYTRQILSDLDKQAREEVERLGGNPYLIAVLDE
LLAWKKGQNSSSEI
NT seq 945 nt   +upstreamnt  +downstreamnt
atggattccgaaaaaaacggagtgccttattcgcaaagtggcgacaaagagcaggatgag
aaacttttgcaaccattcacatacattcttcaagtgcctggaaaacaaattagaggaaaa
ctagcccatgccttcaattactggttaaaaattccagtagaaaagctacaggcagttgga
gacattacacaaatgctgcataattccagtttactcatagacgacattcaagacaactcc
atacttcgtagaggcattccagttgcacattcaatttatggagttgcaagtacaataaat
gctgccaattacgtactgtttattgcactagaacgagtaatatctctcaatcatccagag
gccactcaagtgtacacggaacaacttctagagcttcaccgaggccaaggaatggaaata
tattggagagataacttcatttgtccttcagaagctgaatataggactatgactattcgc
aaaacgggaggactattcaacttggccgttcgtctgatgcaacttttctcagattgtaaa
gaggacttcacaccattagctgggatattaggtttatacttccaaataagggacgattat
tgtaatttatgtttgcaagagtatacggaaaacaagagttattgtgaagatctttccgag
ggaaaattcagttttccgatcattcacgctatacaaagcaacgcagatgatggccaagtt
ttgaatattttacgacagagaacaaaaaacgtcgaggtgaaaagatactgcgtcaattta
ttggataaatttggatcctttgcttacacaagacaaatattgagcgatcttgataagcaa
gcaagagaagaagtcgaaagattaggaggcaatccttacttaatagctgttcttgacgaa
ttgcttgcttggaaaaaaggccaaaattcctcaagtgaaatttaa

DBGET integrated database retrieval system