KEGG   Nasonia vitripennis (jewel wasp): 100122200
Entry
100122200         CDS       T01081                                 
Name
(RefSeq) frizzled-7
  KO
K02432  frizzled 1/7
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
nvi04150  mTOR signaling pathway
nvi04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:nvi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100122200
   04150 mTOR signaling pathway
    100122200
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:nvi04030]
    100122200
G protein-coupled receptors [BR:nvi04030]
 Frizzled / Smoothened family
  100122200
SSDB
Motif
Pfam: Frizzled Fz DUF6338
Other DBs
NCBI-GeneID: 100122200
NCBI-ProteinID: XP_001605802
NASONIABASE: NV13851
UniProt: A0A7M7G759
Position
2
AA seq 580 aa
MTSSSSMPPYLAAAIFGLVLLTTPGSGGALHTKDPLAPHGKCETITISLCKDMPYNETIM
PNLLNHQKQEDAGPEVHQFSPLVKLKCSPDLKFFLCAMYAPVCTILEKALPPCRSLCESA
RNGCERLMNNFGFYWPESMECSKFPENRDGVLCVGKNETTTTEVPALIDDVRLPAPEFHP
PWGNGPKPFGNNNFMLGGRNIGFVCPIYFKIEEQHGYSLKVGNKVEANCGAPCDGMFFTE
TERKFARVWVGTWATLCAASCFFTFLTFLIDTDRFRYPERPIIFLSVCYLMVALAYVVGW
AAGNSISCDKPAPSPVMGVQMASVITQGTKKEMCTILFMVLYFFGMASSIWWVILTLTWF
LAAGLKWGHEAIEANSQYFHLAAWAAPAVKTVSILAMGKVEGDILSGVCYVGLWNVEALR
GFVLAPLCVYLVLGTVFLLAGFVSLFRIRTVMKHDGTKTDKLEKLMIRIGIFSVLYTVPA
LIVIACLFYEQAYFDNWMLTWNKEMCSKPGTQALYAIPCPMGQDARDLSRKPDFEVFMIK
YLMAMIVGITSSFWVWSSKTLTSWRQFFHHIQGRRIDTYV
NT seq 1743 nt   +upstreamnt  +downstreamnt
atgacgagctcctcctcgatgccgccctacctcgcggcggcgatcttcggcctcgtcctg
ctgacgacgcccggcagcggcggggccctccacaccaaggacccgctcgcgccccacggc
aagtgcgagaccatcaccatttcgctctgcaaggacatgccctacaacgagaccatcatg
ccgaacctcctgaaccaccagaagcaggaggacgccgggcccgaggtgcaccagttctcg
cccctcgtcaagctcaagtgcagccccgacctcaagttcttcctctgcgccatgtacgcg
cccgtctgcacgatcctcgagaaggccctgccgccctgcaggagtctctgcgagagcgcc
aggaacggctgcgagagactcatgaataactttggcttctactggcccgagagcatggag
tgctccaagttccccgagaacagggacggtgtgctgtgcgttggcaagaacgagactacc
accaccgaggtgcctgcgctcatagacgacgtcaggctgcctgctccggagttccaccca
ccctggggaaatggccccaagccctttggcaacaacaatttcatgctgggaggcaggaac
atcggtttcgtgtgccccatatactttaagatcgaggagcagcatggttattcgctgaaa
gttggaaacaaggtggaggccaactgtggagccccctgcgacggaatgttcttcaccgag
acggagcgcaagtttgccagagtctgggttggcacctgggccactctgtgcgccgcttcc
tgcttcttcacctttttgaccttcctcatcgataccgacagattcagatatcctgaaagg
ccgataatatttctgtcggtgtgctatttgatggttgcactggcgtacgtggtaggctgg
gccgctggaaacagcatatcctgtgacaaaccagctccatcgcccgttatgggagttcag
atggcttctgtcataactcagggcaccaaaaaggaaatgtgcacaattctctttatggtt
ctctacttctttggaatggcttccagcatttggtgggtcattttgacactcacctggttc
ttggctgctggcttgaagtgggggcacgaggccatagaggctaattcgcaatattttcat
ttagcagcttgggctgcaccagccgtcaagactgtatccattttagcaatgggtaaagtt
gaaggtgacatactctctggagtatgctacgtgggtttgtggaacgtcgaagccctccgg
ggttttgttcttgcgcccctctgcgtctacctggtactgggcacagtattcctcctcgcc
ggctttgtctccctcttccgtattcgcaccgtcatgaaacacgatggtaccaaaactgac
aagctggaaaagctgatgatacgcatcggtatcttttcagtcctgtatacagtgcccgcc
ctcattgttatcgcttgcctcttttacgagcaagcttactttgacaactggatgctcacc
tggaacaaggaaatgtgctccaagccaggaacacaagctctctacgccattccttgccca
atgggccaggatgcacgcgacttgagcagaaagcccgacttcgaggtcttcatgatcaag
tatctgatggcgatgatcgttggaatcacaagtagcttctgggtttggtcaagcaagact
cttaccagttggagacagttttttcatcatattcagggaaggcgtatagacacgtacgta
tag

DBGET integrated database retrieval system