KEGG   Nasonia vitripennis (jewel wasp): 100122278Help
Entry
100122278         CDS       T01081                                 

Definition
(RefSeq) pyridine nucleotide-disulfide oxidoreductase domain-containing protein 1
  KO
K16174  small subunit ribosomal protein S18b, mitochondrial
Organism
nvi  Nasonia vitripennis (jewel wasp)
Brite
Ribosome [BR:nvi03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Small subunit
    100122278
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox K_oxygenase PrpR_N Pyr_redox_3 ThiF DAO GIDA
Motif
Other DBs
NCBI-GeneID: 100122278
NCBI-ProteinID: XP_001605882
NASONIABASE: NV11669
UniProt: K7IRH1
Position
2
AA seq 468 aa AA seqDB search
MEATFVIIGGGISGVSCAESIAFLAPNESIILITASPLIKAVTNVVTLGKTLTQFDVEER
STNSLTELYPSINVINDVVAEVDKNKKTIKTESGNIISYKKLCICTGARPKLICENNIRV
IGIRDTESVEKFMEKLKEAKRIVVVGNGGIATELVHEISGVDVVWVIKDKHISATFVDPG
AAEFFQEKLLKKDSDTESKPVKRMKYTITSGKSEKGGPALGPDWHNNFKLKDSRALPTSI
QVEYECEVHKIINQSEISHNETEKWPIYVELTNGKIIGCDIVVSATGVIPNSNMVGLESL
KKATDGGYIVDWKLETSEKDIFAAGDVCTAGWDIAWHWIQMRLWTQAHQMGRYAAKSMFS
TLIDEEFLQDFCFELFTHVTKFFGYKVILLGLYNGQKLDKDYEILLRVTKGHEYVKLILS
DGKLQGAVLIGETDLEEMCENLILDQLDLSIYGEDLLNPDIDIEDYFD
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atggaagccacttttgtaataattggtgggggcatttcaggagtgtcttgcgctgaaagt
attgcatttcttgctcctaatgaaagtataattttaataacagcaagtccattgataaaa
gccgttaccaacgttgtaactcttggaaaaacattgacacaatttgatgtagaagaacgc
tcaacaaactcattgacggaactgtatccgtcaataaatgtaatcaacgatgtagtagct
gaagttgacaaaaacaaaaaaactataaaaacagagagtggaaatataattagctataag
aaattgtgcatctgtacaggagcacggccgaaactgatttgcgaaaataacatcagagtc
ataggtattcgcgacactgaatcagtagaaaagtttatggaaaaattgaaagaagccaag
agaatcgttgtggtcgggaatggaggaatcgcaaccgaacttgttcacgaaataagcgga
gtcgacgtagtatgggtaataaaagataaacatatatcagcaacgtttgttgaccctggc
gctgcggaatttttccaagagaaacttttgaaaaaggattcagatacagagagtaaacct
gttaaacgaatgaagtacacaataacaagtggtaagtctgaaaaaggtggacctgcgctt
ggaccagactggcacaataattttaaattaaaggattctcgtgctttgccaacttctatt
caagtagaatatgaatgtgaagtacacaaaattataaatcaatcagaaattagtcacaat
gaaacagaaaaatggcctatctatgtagagttaaccaatggtaagatcataggatgcgat
attgtagtttctgctactggtgtcataccaaacagtaatatggttggattagaatccttg
aagaaagcaacagatggtggttatatcgttgattggaagttagagacgtcagaaaaggat
atttttgcagctggagatgtttgtacggcaggttgggatattgcatggcattggatccag
atgagattatggactcaagcccatcaaatgggtcgttatgctgcaaaatccatgttttct
acgctgatagatgaagagtttttacaagatttttgctttgagctttttacacatgtgacc
aaattttttggttataaagtaattctgcttgggctctacaatgggcaaaagttagacaag
gattatgaaattttgttaagagtaaccaaaggacatgaatacgttaaacttattcttagt
gatggaaaattacaaggagcagtcttaattggagagacagatttggaagaaatgtgcgaa
aatttaatacttgatcagctagatcttagtatatatggtgaagatttgttaaatccagac
atcgacatagaggactactttgattaa

DBGET integrated database retrieval system