KEGG   Nasonia vitripennis (jewel wasp): 100122338
Entry
100122338         CDS       T01081                                 
Name
(RefSeq) hsp70-binding protein 1 isoform X2
  KO
K09562  hsp70-interacting protein
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
nvi04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:nvi00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100122338
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:nvi03110]
    100122338
Chaperones and folding catalysts [BR:nvi03110]
 Other chaperones and cochaperones
  Others
   100122338
SSDB
Motif
Pfam: Fes1 HEAT
Other DBs
NCBI-GeneID: 100122338
NCBI-ProteinID: XP_001605940
NASONIABASE: NV10146
UniProt: A0A7M7G7B0
Position
1
AA seq 362 aa
MDRNPNSQNQNTGQDSAGSNARPLSIEAPRTNQNPNNVEILPNQPRQPRNLQGLLRFAAE
ATKAEDAPSDSRFCPMDEERKNFLNEALSSMAVNVIEELQKDVKLLHNVMDVRVEDDPSQ
YEAALDRIADLADSMDVANDFYKIGGFSVFGPCLNSPHSGIRWRVANVIAELTQNNPFCQ
EKVLEAGFMPILLSMVDTDPSDMARIKALYAVSCIVRGHALALRYMEINDGYSVLMRAIQ
SPVEKLQIKSAFLLSALCNKDKGNDLKLTLIKMGLIEQAAGLLAMGSLLPETREQLLSVL
NGLTNDNYFPALKECRRPELCLKQTLERHLKESKEEESIDREDICKELLDKIFADQDAEQ
ER
NT seq 1089 nt   +upstreamnt  +downstreamnt
atggacagaaatccaaattcacaaaatcaaaatacagggcaagacagtgcaggcagtaac
gcgcggcctttatcaatagaagcgcctagaacaaaccagaaccctaataatgttgaaata
ctgcccaatcaaccaagacaacctaggaatctgcagggtttgttgagatttgctgcagaa
gcaacaaaagctgaagatgctccaagtgattccaggttttgtcccatggatgaggagcgg
aaaaactttcttaatgaagcactgtcttcgatggcagttaatgtaattgaagaattgcaa
aaagatgtaaaattattacataatgtaatggatgtaagagtagaagatgatccctcacag
tacgaggctgcgctagacagaattgcagatcttgccgacagcatggatgtggcaaacgac
ttttacaaaattggaggcttctctgtttttggaccttgtttgaattctccacatagtggt
attcgctggagagtggctaatgtcatagctgaattaacacaaaataatccattctgtcaa
gaaaaagttctggaagctggttttatgcctatactactaagtatggtggacaccgatcct
tctgatatggcaagaatcaaagcactttatgcggtttcatgtattgtcagaggccatgct
cttgcattgaggtatatggaaataaatgacggttactccgttttgatgagagctatacaa
agcccagtggaaaagttgcagattaaatctgcatttttattgtcagctttatgcaacaaa
gacaaaggaaacgatttgaaattaacattaataaaaatgggattgattgaacaagctgct
ggcttgcttgcaatgggaagtttacttccagagacaagggaacaactcctcagtgtactt
aatggactaacaaatgacaattatttccctgctctgaaagaatgcagacgtcctgaacta
tgtttaaaacaaactttggaaagacatttgaaagaatcaaaagaagaagagagtatagac
agagaagatatatgtaaagaacttttagataaaatttttgctgaccaagatgcagagcaa
gaacgatag

DBGET integrated database retrieval system