KEGG   Nasonia vitripennis (jewel wasp): 100122411Help
Entry
100122411         CDS       T01081                                 

Definition
(RefSeq) baculoviral IAP repeat-containing protein 7-like
  KO
K16061  baculoviral IAP repeat-containing protein 7/8
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
nvi04120  Ubiquitin mediated proteolysis
nvi04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100122411
 Cellular Processes
  Cell growth and death
   04215 Apoptosis - multiple species
    100122411
Ubiquitin system [BR:nvi04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    100122411
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BIR zf-C3HC4_3 Prok-RING_4 zf-RING_5
Motif
Other DBs
NCBI-GeneID: 100122411
NCBI-ProteinID: XP_016838993
NASONIABASE: NV14467
Position
3
AA seq 460 aa AA seqDB search
MMKTMFRTNPIGDLHRSENKMAGLLDRRDNSFMSPLKFMPNPTPRAPTPPQPESNEVDDA
GSMDYRFEEVRLQSFENWPSEHVRPADLAAAGFYFTKQIDRVRCFECSTEVCRWEQGDDP
MVEHQRWGGRCRFIRKLPCGNVPIGADPSMIPAPRPRSRDVCGPYKLDYRLGAEADTHAS
CSGTRQGRQAMSEEPPKQPSAARLGSMGIGIPRRPDFPDYASYEARLLTFNDWPSTRVSQ
TKEQLADAGFFYTGTGDQTTCYHCGGGLKNWEPKDDPWVQHAKWFSTCFYVRLVKGQEFI
NNVNGKHATPLSEEDKMALPSCIKQVEQQPIKKLEQEDVPQQQNQQTEVNESRPGPSSVE
CPVPAPRMNAESQAQTSAASVPMVNGNASSSSVSEDKPQQTSEKKSIDDARVCKICYNEE
LGVVFLPCGHMVACVKCAPGMTTCAVCREPVAMTVRAFFS
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgatgaagaccatgttcagaacaaacccaattggtgacctgcacaggtcagagaataag
atggctggattgctggatcgcagggacaactcgtttatgtccccactgaaatttatgcca
aatccaactcctagagcacctacgccaccccagcctgaatccaacgaggttgatgatgct
ggaagcatggactataggtttgaagaagtgagactgcagagctttgagaactggccgtca
gaacacgtgcggccagcggacctggcagctgcaggcttctacttcaccaagcagatagac
cgagtgcgttgtttcgaatgctccacggaggtctgccgctgggaacagggagacgatcct
atggtcgagcaccaacgctggggcggtcgatgccgttttatcaggaaattgccttgcggt
aacgtgcccatcggtgccgatccaagcatgatccctgctccccgtccacgaagccgtgac
gtttgcggaccgtacaagctggattatagactaggagccgaggccgacacccatgcctcg
tgtagtggaaccaggcagggcaggcaagcaatgagcgaggaaccgccgaagcagccttca
gctgccaggttgggcagtatgggcattggcattccgagacgacctgactttccggattac
gctagctacgaagcaagactgctgacctttaacgactggccgtcgacgcgcgtttcccag
acgaaagaacaactggcggatgctggatttttttacaccgggactggtgaccagactacc
tgctatcactgcggaggcggactgaaaaactgggagcccaaggacgatccgtgggtacag
cacgccaagtggttctccacctgtttctacgttcgattggtcaagggtcaggaattcatc
aataatgtaaacggaaagcacgcgacaccgctatcggaagaggataaaatggcactccca
agttgtattaagcaagtagaacaacaaccaattaaaaaattagaacaagaagatgtaccg
caacaacagaatcagcaaaccgaagtaaacgagagcagacctggacctagcagcgttgag
tgcccggttccggcgccacgaatgaatgcagaatcgcaagcgcagacatcagccgcatca
gttccaatggtaaatggcaatgctagcagtagtagtgtaagcgaagacaaacctcaacag
acaagcgagaaaaagtctatcgatgatgcgcgagtttgcaagatctgctacaacgaagag
ctcggggtggtgttcctgccatgcggtcacatggtcgcctgcgtgaagtgtgccccgggt
atgacgacgtgcgctgtttgccgggaacccgtcgctatgaccgtgcgcgccttcttctcc
tag

DBGET integrated database retrieval system