KEGG   Nasonia vitripennis (jewel wasp): 100122600
Entry
100122600         CDS       T01081                                 

Definition
(RefSeq) neutral ceramidase isoform X1
  KO
K12349  neutral ceramidase [EC:3.5.1.23]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
nvi00600  Sphingolipid metabolism
nvi01100  Metabolic pathways
Module
nvi_M00099  Sphingosine biosynthesis
Brite
KEGG Orthology (KO) [BR:nvi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    100122600
Enzymes [BR:nvi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.23  ceramidase
     100122600
SSDB
Motif
Pfam: Ceramidase_alk Ceramidse_alk_C
Other DBs
NCBI-GeneID: 100122600
NCBI-ProteinID: XP_001606211
NASONIABASE: NV12533
Position
3
AA seq 713 aa
MDSLRNRLRPRKCGLIMTSLLIGILVPNVVSSYSIGVGISDTTGPVAEIVFMGYAKMDQK
GSGLHLRTFARSFIIDDGQHRFVFVTVDSAMVGHDVKAAVLRNLQSHYGDLYTESNVMIS
ATHTHSAPGGFMMDVLFDISTYGFVKESFTALVNGIAKSIDKAHNAVVPGRIFITRGEVL
EANINRSPLAYLNNPEEERNKYKYDVDKDLVQLQFIAANGKPLGVINWFAVHPTSMNNTN
HLVSSDNVGFASVLFEKRINKNAMVGKGDFVAAFASTNLGDVSPNTRGPKCEFSGQHCTV
QYTCPGKKEMCFASGPGKDIFESTSIIANKILDEAWKLWGSGSVTEVKGPVRIVHRFVDM
PKQSATFYNATTQKVEEVHGCLPAMGYSFAAGTTDGPGSFAFEQGTTTSNPFWNTVRNFL
AKPTDEDVRCHGAKPILLATGRMKLPYQWQPKIVSTHLALIGNVAIAGVPGEFTTMSGRR
LRDTVKTAIVEADKSFENANVILAGLCNTYSDYVATPEEYQLQRYEGASTIFGPHTLTIY
LKQYAELAKHAVLDETVEPGPNPPDLSKEKLISLVPPVIYDAPKWGREFGDCVKQPMRTA
RPGDVVTARFISGHPRNNFMTGSTYLTVERLEEDETWTPVATDADWETKFIWERTSSILG
SSQVITSWEVPENVIPGEYRIRHNGYYRYILGGVYPYQGVTNHFQVKTPNLNY
NT seq 2142 nt   +upstreamnt  +downstreamnt
atggattcgctgaggaacaggctacggcctcgaaaatgtggtctaattatgacctctcta
ctaattggaatactcgtgccgaacgtagtttcatcctacagtattggcgtgggtatctcc
gatacaactggacccgtcgcggagatcgtctttatgggctatgccaagatggatcagaag
ggctcggggcttcatttgcggacattcgcccggtcattcatcatcgacgatggccagcac
aggttcgtcttcgtcacagtggacagcgcgatggtcggtcacgatgtgaaggctgcggtc
cttcgaaatcttcagtcgcattacggcgacttgtacacggaaagcaacgtcatgattagc
gccactcatacgcactcagccccgggcggcttcatgatggacgtactctttgacatctct
acttacggtttcgtgaaggaatcctttactgctttggtcaacggaatcgccaagagtatt
gacaaggcccacaatgccgttgttccggggcgcatattcattacacgcggcgaggtatta
gaggccaatatcaatcgaagtccattggcttatctgaacaatcctgaagaggagagaaac
aaatataagtatgacgtagataaggacttggtacagcttcaattcatcgctgcgaacgga
aaaccgctcggagttatcaactggttcgccgtccacccgactagtatgaacaatacgaac
cacctcgtgtccagtgacaacgtcggttttgcgtcggtactcttcgagaagcggataaac
aagaacgccatggttggaaagggtgactttgtggctgcctttgcttccacgaatttgggt
gacgtttcgcctaatacacgcggtccgaagtgtgaattttccggtcaacattgcacggtg
cagtacacttgcccaggtaaaaaggaaatgtgcttcgcatcgggaccaggaaaggacata
tttgagagtacgagcataattgcaaacaagattttggacgaagcttggaaattatggggt
agcggttcggttaccgaggtgaaaggacccgtacgcatcgttcaccgcttcgtcgacatg
ccaaaacagagtgctaccttctacaacgcgactacccagaaggtcgaggaggtgcacggc
tgtctgccagcaatgggctacagcttcgcagctggtacgactgacggcccaggctcgttc
gctttcgagcagggcacgaccacgtcaaatcccttctggaacacggtgcgcaatttcttg
gccaagccgaccgacgaggatgtccgctgccatggcgccaagccaattctgctagccacg
gggcggatgaagctaccgtaccagtggcagccgaagatcgtctcgacgcatttggcgctc
atcggaaatgtggccattgccggcgtgcccggtgaatttacgaccatgtctggcaggaga
ctgagggacactgtgaaaacggccatcgttgaggcggacaaatcctttgagaatgcgaac
gttattctggctggcctctgcaacacttacagcgattacgttgccacacccgaggagtat
caactccagaggtacgaaggagcatcaacgattttcggaccgcacacccttaccatttac
ctcaaacagtacgccgagcttgccaagcacgcagtgctcgacgaaactgtcgagccagga
ccaaatcccccggatctatcaaaggagaagttgatcagcttggtgccgcctgtgatttac
gatgcgccaaagtggggcagagaatttggcgactgtgttaagcaaccgatgcgaaccgct
cgtcctggagacgttgttaccgccagatttatttcgggacatccaagaaataattttatg
actggaagtacatatttgacagttgaacgtttggaagaagacgaaacttggactcctgtt
gctacagatgcagactgggaaactaaatttatttgggaaaggacgtctagcattcttggc
tcaagtcaagtgattacctcatgggaagttccagaaaatgtcataccaggagagtaccga
attcgacacaatggttactaccgctatattcttggtggagtttatccctatcaaggtgtt
accaaccattttcaggtcaaaaccccaaatttgaactactaa

DBGET integrated database retrieval system