KEGG   Nasonia vitripennis (jewel wasp): 100122751Help
Entry
100122751         CDS       T01081                                 

Definition
(RefSeq) histone H2B
  KO
K11252  histone H2B
Organism
nvi  Nasonia vitripennis (jewel wasp)
Brite
Chromosome and associated proteins [BR:nvi03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    100122751
Exosome [BR:nvi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100122751
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like DUF1931
Motif
Other DBs
NCBI-GeneID: 100122751
NCBI-ProteinID: XP_001607945
NASONIABASE: NV12304
UniProt: K7IT51
Position
5
AA seq 124 aa AA seqDB search
MAPKASGKAVKKAGKAVKNITKGDKKKHKKRRKESYAIYIYKVLKQVHPDTGVSSKAMSI
MNSFVNDIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKY
TSSK
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atggcaccgaaggctagcggaaaggcggtgaagaaggccggcaaggccgtgaagaacatc
accaagggcgacaagaagaagcacaagaagcgcaggaaggagagctacgcgatctacatc
tacaaggtgctgaagcaggtccaccccgacaccggcgtgtcgagcaaggccatgagcatc
atgaacagcttcgtcaacgacatcttcgagcgcatcgccgccgaggcctcccggctggcc
cactacaacaagaggtcgaccatcacctcccgggagatccagacggccgtcaggctcctg
cttcccggtgagctggccaagcacgccgtcagcgagggcaccaaggccgtcaccaagtac
accagctccaagtaa

DBGET integrated database retrieval system