KEGG   Nasonia vitripennis (jewel wasp): 100122790
Entry
100122790         CDS       T01081                                 
Name
(RefSeq) synaptosomal-associated protein 29
  KO
K08509  synaptosomal-associated protein 29
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
nvi04130  SNARE interactions in vesicular transport
nvi04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:nvi00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    100122790
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100122790
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:nvi04131]
    100122790
Membrane trafficking [BR:nvi04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    100122790
 SNARE
  SNAP-25 (Qb,c)
   SNAP-29
    100122790
SSDB
Motif
Pfam: V-SNARE_C CENP-Q Gemini_AL1 DUF5089 FapA
Other DBs
NCBI-GeneID: 100122790
NCBI-ProteinID: XP_001606393
NASONIABASE: NV12545
UniProt: A0A7M7G8I2
Position
3
AA seq 275 aa
MAGHNYLSDPKNPFFSLEDDVDDDTFLRSAPPRCPTTSNNHYQNYDNTLEKKHQELLQRK
KEIEERTIKSSQRSISVLRDTEEVGTATAEELIRQREQLERTDRRLDDINSTLRFSQKHI
QGIKSVFGGLKNYFSGSKSMDVPPGSSAGGIKTPESAMSPTSPTSPISNSSLADKLNSSV
ENARRNSEHPSFRLRGMTEEEEDFRPDPTKNIAAVLEKNLDEMSGSIARLKGLAIGLSEE
IETQNDLIDNITDKAEKADITLQRQNKDIRNLLKK
NT seq 828 nt   +upstreamnt  +downstreamnt
atggctggtcacaattatctcagtgacccaaaaaatccattcttctcgttagaagatgat
gtggatgatgatacattcttacgaagtgccccgccaaggtgtccaactacttccaataat
cattatcaaaattatgataacacgcttgaaaagaagcatcaagaactactccagcgaaaa
aaagaaatagaggaaagaacaattaaatcctctcaacgctctatatcagtactacgtgac
acagaagaagttggaactgcaactgcagaggaattgattaggcaacgagaacagttagaa
agaactgacaggcgtttggatgatattaacagcacattaagattcagtcaaaaacacatt
caaggtataaaaagtgtttttggtggattgaaaaactatttcagtggtagtaaatctatg
gacgtgcctcccggttcaagtgctggtggaatcaaaactcctgaatctgcaatgtctcct
acatccccaacatctccaatctctaacagttctctagcagataagttaaacagttctgtc
gagaatgcaagacgaaactcagaacatccatctttccgtcttcgaggtatgacagaagaa
gaagaagattttcgtcccgatcctactaaaaatatagctgctgtgttggagaaaaattta
gatgaaatgagtggctctattgcaagactaaaaggtttagctattggtttatctgaagaa
attgagacacaaaatgatttaattgataacatcacagacaaagcagaaaaggcagatata
acactgcagcgacaaaataaggacattagaaatctattaaagaagtaa

DBGET integrated database retrieval system