KEGG   Nasonia vitripennis (jewel wasp): 100122811
Entry
100122811         CDS       T01081                                 
Name
(RefSeq) dehydrodolichyl diphosphate synthase complex subunit DHDDS
  KO
K11778  ditrans,polycis-polyprenyl diphosphate synthase [EC:2.5.1.87]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
nvi00900  Terpenoid backbone biosynthesis
Brite
KEGG Orthology (KO) [BR:nvi00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    100122811
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:nvi01006]
    100122811
Enzymes [BR:nvi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.87  ditrans,polycis-polyprenyl diphosphate synthase [(2E,6E)-farnesyl diphosphate specific]
     100122811
Prenyltransferases [BR:nvi01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   100122811
SSDB
Motif
Pfam: Prenyltransf
Other DBs
NCBI-GeneID: 100122811
NCBI-ProteinID: XP_008213609
NASONIABASE: NV12013
UniProt: A0A7M7H9U4
Position
3
AA seq 300 aa
MSWIAKNTLTWLQSIVIKILRTGNIPRHVAIIMDGNRRYANKIGVERLEGHSKGFEKLAE
TLQWCLEFGIPEVTVYAFSIENFKRSDKEVDGLMDLARRKFQRLLDERDKLMEHGVCIRI
IGNLSFVPQDVRSLMAEAMRITKDNNKAFLNVAFSYTSRDEITNTVSDIVRHVKNGDITV
DDIDENLFSKCLYTHNSEDPDLLIRTSGEVRFSDFLMWQTSHTCVYFTKVLWPEFSAWDL
IYAVFYYQRCYSDIMQLKNDSQDKVSVLNNRTSNFVKKLHKERDTMLESTSHITILNGKH
NT seq 903 nt   +upstreamnt  +downstreamnt
atgtcttggatagcgaagaacactcttacctggttgcagtctattgtgatcaaaatattg
aggacgggcaacatacccagacatgttgctattatcatggatggcaacaggaggtatgcc
aataaaattggagtcgagagactggaaggacattcgaaaggttttgaaaagctagccgaa
acactgcagtggtgtctagaatttggcattccagaagtaactgtgtacgcttttagtata
gaaaattttaaaaggagtgataaagaggtggacggtctcatggaccttgcaagacgaaaa
ttccaaaggttattagatgaaagggataagttgatggagcatggtgtgtgtattagaatt
ataggtaacttatcttttgtacctcaagatgttcgttctctgatggcagaagctatgcgt
atcactaaagataataacaaagcatttctaaatgtagcgttctcttacacgtcgagagat
gaaataacaaatactgtaagtgatatagtcaggcatgtgaaaaatggtgacataacggta
gatgacatagatgagaatctcttttccaagtgcctttacacgcacaattctgaagatcca
gatttacttataagaacttctggagaagttcgtttcagtgacttcctgatgtggcaaaca
agtcatacgtgtgtttacttcacaaaagttctttggcccgagttcagtgcctgggacctc
atatatgcagtgttctattatcaaaggtgttacagtgatatcatgcaactgaagaatgat
agccaagataaagtatcagtgttgaataatagaactagcaactttgttaaaaaattacac
aaagaaagggacacaatgcttgaaagcacgtcgcatattacgatattaaacggaaaacat
tag

DBGET integrated database retrieval system