KEGG   Nasonia vitripennis (jewel wasp): 100122815
Entry
100122815         CDS       T01081                                 

Definition
(RefSeq) serine/threonine-protein kinase ULK3
  KO
K21358  serine/threonine-protein kinase ULK3 [EC:2.7.11.1]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Brite
KEGG Orthology (KO) [BR:nvi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nvi01001]
    100122815
Enzymes [BR:nvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100122815
Protein kinases [BR:nvi01001]
 Serine/threonine kinases: Other
  ULK family [OT]
   100122815
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr MIT Kdo APH Abi_2
Other DBs
NCBI-GeneID: 100122815
NCBI-ProteinID: XP_031780777
NASONIABASE: NV13513
Position
2
AA seq 485 aa
MSLPSVKDYTLLEKIGAGSYSTVYKAFKRDGSREVVAIKCVDKSTLSKSAIDNLITEINL
LKILKHEHIVEMRDFFWDEGHIYIVMEYCDGGDLSNFIKRKHKLAEHVCRKFLQQLALAL
RYLRNHNVCHMDLKPQNLLLIKRPALVLKVGDFGFAQYLSSSETKFSIRGSPLYMAPEIL
LRHKYDARVDLWSVGVIMYECLFGKAPYSSNSFPELAEKIKDMRPIELPKGCHISGECKD
LLLRLLKHNPDERLTFDEFFAHDFLDLEHAPTRENLDKAVALVHKAVKSDADGCRREAYH
LYCEALRYFIPVLTSETDLQKKEALRLRVNEYIRRAEQLKDTCAEADQRRKSENGAHQAA
ETTNSQQPVSRCDSLERNAAINFLELRTLSKSTTGMSAALEIGESAEQYLAEGNYDLALE
KFQSCLKVLVPLLGKEPPGRRRELLSKQVHKWMKEAESTKGLLITKEMESNAQRTSESQE
QCSLQ
NT seq 1458 nt   +upstreamnt  +downstreamnt
atgagtctgcccagcgtcaaggactacacactgctggagaaaatcggggctggcagctac
tccacggtgtacaaagccttcaagagggatggctctcgcgaggtggtggcgatcaagtgc
gtggacaagtcgaccctctcgaaatcggcgatcgacaatctcattacggaaattaattta
ctcaagatactcaaacacgagcacatcgtcgaaatgcgcgacttcttctgggacgagggg
cacatctatatcgtgatggagtattgcgacggtggcgatctgtcgaacttcatcaaacga
aagcataagctggccgagcacgtctgtagaaagtttttgcagcagctcgcgctagcgctc
aggtacctgcgcaaccacaatgtctgtcacatggatttgaagccgcagaatctgctgctt
atcaaaaggcccgccctcgtgctcaaagttggagacttcggtttcgcccagtacctgagc
agttcggagaccaagttttcgatacgaggctcgcctctgtacatggcaccggagatactg
ctgcggcacaagtacgacgccagggtggacctgtggagcgtcggcgtcatcatgtacgag
tgtctattcggcaaggcgccgtactcgagcaacagctttcccgaactcgccgagaagatc
aaagacatgaggccgatcgagctgcccaagggatgtcacatatccggcgagtgcaaggac
ctgctgttgcggctcttgaagcacaacccggacgagcggctgaccttcgacgagttcttc
gcgcacgacttcctcgacctggagcacgcgccgacgcgcgagaacttggacaaggccgtc
gctctcgtccacaaggctgtgaaatccgacgcggacggctgtcgcagggaggcctatcat
ctctactgcgaggctctccgctacttcattcctgtactcacaagcgagactgatttgcag
aagaaggaggcgctgagactgagggtgaacgagtacatcaggcgagcggaacaattaaag
gacacgtgtgcggaggctgatcagaggcggaagagcgagaacggggcgcatcaggccgcg
gagactaccaactcgcagcagccagtctcgaggtgcgactcgctcgagagaaacgctgcg
atcaattttctcgaactacgtacgctaagcaagagcacgacgggcatgtcggcggcgcta
gagatcggcgagtcggccgagcagtacctggctgagggcaactacgatctggctctcgag
aagtttcaatcctgcctgaaagtcctggtgccgctgctgggcaaagagccgccggggcgc
agacgcgagctcctctccaagcaggttcacaaatggatgaaggaagcagaaagcaccaag
ggccttcttatcacgaaagagatggaaagtaacgcgcagcgcacctcagagtctcaagag
cagtgttcattacaatga

DBGET integrated database retrieval system