KEGG   Nasonia vitripennis (jewel wasp): 100122901
Entry
100122901         CDS       T01081                                 
Name
(RefSeq) apoptotic chromatin condensation inducer in the nucleus
  KO
K12875  apoptotic chromatin condensation inducer in the nucleus
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
nvi03013  Nucleocytoplasmic transport
nvi03015  mRNA surveillance pathway
nvi03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:nvi00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    100122901
  09122 Translation
   03013 Nucleocytoplasmic transport
    100122901
   03015 mRNA surveillance pathway
    100122901
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:nvi03019]
    100122901
   03041 Spliceosome [BR:nvi03041]
    100122901
Messenger RNA biogenesis [BR:nvi03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    EJC complex
     100122901
Spliceosome [BR:nvi03041]
 Complex C
  Other components
   EJC/TREX
    100122901
SSDB
Motif
Pfam: RSB_motif RRM_1
Other DBs
NCBI-GeneID: 100122901
NCBI-ProteinID: XP_031778495
NASONIABASE: NV11231
Position
2
AA seq 931 aa
MRRKSERNKAKGTPEKKVEKPTRRTTRRRGKEVTPEPSPDRENTEENASNSQLSAEEDQD
SRLEQESSQAETMEKPVTSSELIKSVLGADEEDNGSVWKVARADASPGEIQKLKLCRQRN
TSEASDSSSSKKKSNKWPDSGEGGTEEADSADEQVASSKNVLIDEQSDDTSSLHPGQDSH
QEVSDHKENLPETISANLSDDKTNIDQLAECTENLPKTTTNLSEQFNSEDGKAENSTSAN
LPGNYSNSSQSPAGTDNVAEIASDNSSNNQQIQDTQDNSDEPACVNSTTAEPLQDVNVTS
DTNNEFTNNQVIPTGNVQLHEEETTNRSNESCDSEVVEKETSEQESSSEGNTSVRKRDNL
ETTSKDDKISPETDQELGNQENEGDEKAIKSTSTESDSVSNEKEESIAQDVDMAESQESD
TQSSQQNHHVQYESSASDKSESEDEKRTEKDKADSSNEKKNIHRGNRKRLQDQSASKQVR
SDSDIIEPELELSESIIEKDDILEIIEKSDDLNSSMSTSKPAKVSLKRSFSARISTDSEV
KKEDTKNASAVNESNQNKENHADNEQPDQKSCTKRRRWGMTTTSDVAPAFSISTDSLKAL
VPGAKPLSVNEVKLDKDQDEEKVHRKIKDQVPDHKAKSDVVSKNDITTKKEIKDNHIAPR
RKITVVKEAPRPSSPSLPEPQATNVLLIKNLVRPFTLHQIKELLSRTGTIVENGFWIDRI
KSKCFVEYTNEDQAFETRQALHGVSWPLSNPKKLIVEYATKEDMEAARESSKDQPIARKT
EPLVSADMWQQDQWSREERTPIVNKITVIREWDLGKEDGQLHVKEKERERKEFEKKKRQR
SRSPVIEVHLPAPARKFKKKEEEPPTAKLLDDLFRKTKATPCIYWLPLTNEQIIVKEEMR
RQHMAEHARRLEEMRRAERSRDTRRRRSPRK
NT seq 2796 nt   +upstreamnt  +downstreamnt
atgcggcgtaaaagtgagaggaacaaggccaagggcactccagagaagaaggttgagaaa
ccaactagaagaacaacacgccgaagaggtaaagaagtaactcctgaaccatcgccagac
agggaaaatacagaagaaaatgcatcgaactcacaattatctgcagaggaagatcaggat
tcgagacttgaacaggaaagcagccaagcggagactatggaaaaaccagtcacatccagt
gagctcatcaaatccgttcttggagctgatgaagaggacaatggatcagtatggaaagta
gcgagagctgatgcatcacctggagaaatacagaagctgaaactttgtaggcaacgaaat
acttcagaagcgtcagacagtagttcaagcaaaaaaaaatcaaacaagtggccagatagt
ggtgaaggtggcacggaggaggctgattcggctgatgagcaagtagcatcttcaaagaat
gtgcttattgacgaacagtctgatgatacctcctccttgcacccaggtcaggactcccat
caagaggtaagtgatcacaaggagaacctgcctgaaaccatttcagccaacttgtctgat
gataaaacaaacatagatcagctggcagagtgcacggagaatctaccaaaaactactact
aatttgtctgaacaattcaattcagaggatggcaaggctgaaaattctacctctgccaat
ctacctggtaattattcaaactctagccaatctccagctggcacggataacgttgcagaa
atagcttctgacaattcatcaaacaatcaacaaattcaagacactcaagacaactccgat
gaaccagcttgcgttaattctaccacagcagagcctcttcaagatgttaatgttacttct
gatacaaataatgaatttactaataaccaagtcattcctactggaaatgtgcaattacat
gaagaagaaactactaatcgttcaaatgaatcttgtgattcagaggttgttgaaaaagaa
acatctgaacaagaaagttcttcagaaggaaatacttctgtacgcaaacgagataatttg
gaaactacatcaaaagatgataagataagtccagagactgatcaagaattgggaaatcaa
gaaaatgaaggggatgaaaaggcaataaaatcaacatcaacagaatctgatagtgtatca
aatgaaaaagaagagtcaattgcccaagatgttgacatggcagaatctcaggaatcagat
acccaatcatcacagcaaaaccatcatgtacaatatgaatcttcagcatcagataaatct
gaatcagaagatgaaaagagaacagaaaaggataaagctgattcttcaaatgaaaaaaaa
aatatacatagaggcaacagaaaaagattgcaagaccagtcagcttctaagcaagtaaga
agtgattctgacatcatagaacctgaactagaattatcagaaagtattattgaaaaagat
gatattcttgaaattattgaaaaatctgatgacttaaattcatcaatgtcaacttcaaaa
cctgccaaagttagtctcaagaggtcattctctgcccgaatctcaacagattctgaagta
aaaaaggaagacactaaaaacgcatctgctgttaatgaatccaatcaaaacaaagaaaat
catgcagataacgaacaaccagatcagaaaagttgtactaaaagacgacgttggggaatg
acgacaacttctgatgttgccccagcattttcgatttcaacagattccttaaaggctctt
gttccaggtgcaaagcctttatctgttaatgaagtaaaacttgataaggaccaagatgaa
gaaaaagtgcatcgaaaaattaaggatcaagttccagatcataaagctaaaagtgatgta
gtttcaaaaaatgacattaccacgaaaaaagaaattaaagacaatcatatagcgccaaga
cgaaaaataaccgtggtcaaagaggcgccaagaccctcgtcaccaagtctaccagaacct
caagcaacaaacgtcttgttgataaaaaatttagtacgaccctttacattacaccaaatc
aaagagcttctttcgcgcactggaactatcgtcgaaaatggtttttggatagatagaata
aaatcaaaatgttttgttgagtatactaatgaagatcaagctttcgaaacaaggcaagca
ttgcatggagtttcttggcccctttcaaatccaaagaagctaattgtagaatatgctaca
aaagaagatatggaagcagctcgagagtcatcaaaagatcagcctatagcaaggaaaact
gaacctttggtttcagctgacatgtggcagcaggatcagtggtcacgagaagaaaggaca
ccaattgtaaacaagattacagttatccgtgagtgggatttagggaaggaagacggtcaa
ttacacgttaaagaaaaagagcgagaacgaaaagaattcgaaaagaaaaaaagacagaga
agtagaagtccggtaattgaagtacatctacctgcaccagctaggaaattcaagaaaaaa
gaagaagagccacctacagcaaaacttttagatgacctctttagaaaaaccaaagccaca
ccttgcatatattggttgccattaacaaatgaacagattattgtaaaagaagaaatgaga
aggcagcatatggccgaacatgcgcgtagattagaagaaatgaggcgagctgaacggagt
cgagatacgcgacgtcgtcgtagtcccagaaaataa

DBGET integrated database retrieval system