KEGG   Nasonia vitripennis (jewel wasp): 100123129
Entry
100123129         CDS       T01081                                 
Name
(RefSeq) cell division cycle protein 27 homolog isoform X1
  KO
K03350  anaphase-promoting complex subunit 3
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
nvi04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:nvi00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100123129
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:nvi01009]
    100123129
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:nvi04121]
    100123129
   03036 Chromosome and associated proteins [BR:nvi03036]
    100123129
Protein phosphatases and associated proteins [BR:nvi01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     100123129
Ubiquitin system [BR:nvi04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     100123129
Chromosome and associated proteins [BR:nvi03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    100123129
SSDB
Motif
Pfam: TPR_1 TPR_2 ANAPC3 TPR_8 TPR_16 TPR_11 TPR_19 TPR_17 TPR_12 TPR_14 TPR_6 TPR_7 TPR_9 TPR-S PPTA TPR_20 ChAPs TPR_15 SRP_TPR_like NatA_aux_su Type_III_YscG
Other DBs
NCBI-GeneID: 100123129
NCBI-ProteinID: XP_001606740
NASONIABASE: NV10210
UniProt: A0A7M7LML0
Position
1:34603596..34609392
AA seq 830 aa
MIVQEPVQAAIWHCLNHYAYPDAIFLAERLFAEVDNEETLFLLATSYYRAGKVRQAQALL
SKRSLTSPQCKFLLAKCCYDLGMYAEAEAAIVGGYYKQVKNFDEIVTQFGDEACFSLQII
AKICYKMTRTTKGNEAHRLALKLNPFLWHSFEEVCNTGEKIDAKKIFQLDKLDNLSTCIG
STPVSYYTPEPDLIVSSNNAPITPTTNNVQITPNQGTNGLPNNVRLHSSIEESPQNISNH
MNTCSTMSPRGKPPRYRSMFSSSMSPLTPSFGILPLDINTPEPPAISTHATLTEANDQKS
LAKRQLISRKETPLQQGKLVFSQSGNTSNTANIVTVTPATPVPPQPTLQGPNVRRSSRLF
SHSYSVKENNKSPNRNKFTTPKSPSRKTKTRLSKSNLNKANYNDLNEKNRNEKEKSETIT
SEKVVANTNALNQSNNSTFTSPVTIQKHSAEGLMSLLRKLGEAYNYLCQFKCVDAVEILS
VLPRHHYNTGWVLSMLAKAHFEMIDYKKAANHFAQVRTLEPHRTELMEIYSTVLWHLHAE
VQLSTLAQDLVAEDRNSPAAWCATGNLFSAQTEHETAIKFFQRAIQVNPNFPYAYTLLGH
EYVITEELDKAITAFRNAIRLDPRHYNAWFGLGTIFSKQEQYSLAELHFKRALHINPHNS
AIMCHIGVVQHALKKVDQALNTLNRAIQDDPDNTLCKFHRASINFSIGRNAEALSEFEEL
KNIVPKESLVYYSIGKIHKKLGNTHLALMYFSWATDLDPKGVNSQIKEAILSPGQGEDES
FVAQSAEEQTLNSSTEQEGEASGEASGEGSAVVANVTADAQADDSDDSSL
NT seq 2493 nt   +upstreamnt  +downstreamnt
atgatcgtccaggagccagtccaggcggccatatggcactgcttgaaccactatgcttac
ccagacgcgatattcctggcagaaagattgttcgccgaagtggataacgaagaaacactg
tttcttcttgctacaagctattacagggctggaaaagtgaggcaggcacaagctttgctc
tcaaagcgctcactgacttccccgcagtgcaaattcctgctggcaaagtgctgctatgac
ttgggaatgtatgcagaagcagaggctgccattgttggaggatactacaagcaggtcaaa
aatttcgacgagattgtcacccagtttggagatgaagcttgcttctcgcttcagatcata
gccaagatatgttataaaatgacaaggaccacaaagggaaatgaagctcacaggttggct
ctgaaactcaatccatttttgtggcactcctttgaggaggtgtgcaacactggtgaaaaa
attgacgcaaagaagatattccagctggataagttagataatctatccacatgcattgga
agcaccccagtctcttactatacacctgaaccagatctcattgtatctagcaataatgct
ccgattactccaacaaccaacaatgtccagataacgccaaatcaaggaacaaatggtcta
cctaacaatgttaggctgcactcatcgatagaagagagtccacaaaacatatctaatcac
atgaatacctgttccaccatgtcccctcgtgggaagccacctcgctacagaagcatgttc
agcagctcaatgagtcctttaacgccgagtttcggaatcctgcctttggacatcaacact
ccagagcctccagctatatccacccatgcaacattgacagaagcaaacgatcaaaaaagc
ttggctaaacgccaattgatatcaaggaaagaaacaccactgcaacaaggaaaattggta
ttttcacaatctggtaataccagtaatacagcaaatattgtcacagttactccagcaact
cccgttcctcctcaaccgacgcttcaaggtcctaatgtcaggagatcgtcaaggctgttt
agtcacagctactctgtaaaagaaaacaataaatctccaaacaggaacaaattcacgact
ccgaaatctccttctcgcaaaactaaaacaagactgtcgaaaagtaatctcaataaggca
aattataatgacttgaacgagaaaaatcgaaatgagaaagaaaaaagtgaaacgatcact
tcagagaaggttgtagcaaataccaatgctttaaatcaaagtaataattcaacattcacc
agtcctgtaaccattcaaaagcattcagcagagggtttaatgtctctgttgcgaaaactt
ggagaagcatacaattacttgtgtcaatttaaatgtgtggatgctgttgagatattgtct
gtattgccaagacaccattataatactggctgggtgttgtctatgctagctaaagcacat
ttcgaaatgatagattataaaaaagcagcaaatcattttgcacaagttaggacattagaa
cctcataggactgaattaatggaaatatatagtactgtattgtggcatttacatgctgaa
gtacagctttctacgttagctcaagacttagtagcagaagatcgaaattctccagctgcc
tggtgtgcaactggtaacttgttttctgctcaaactgaacacgagactgctatcaaattc
tttcaaagagctattcaagttaatcccaatttcccttatgcatatactcttcttggacac
gaatatgtaattactgaggaattggataaagctattacagcttttagaaatgctataagg
ctagaccctcgtcattataacgcctggtttggactaggaaccattttctcaaaacaagaa
cagtatagcttagcagagttgcactttaagagggcattacatataaatcctcacaactct
gcaatcatgtgccacataggtgttgttcaacacgctttaaagaaagtcgaccaagcttta
aatacattaaatcgagcaatccaagatgaccctgacaatactctttgtaaattccatcgc
gcgagtattaatttctcaattggtagaaatgcagaggctctcagtgagttcgaagaactg
aaaaatatcgtacccaaagagtcactagtctattattctataggaaaaattcataaaaaa
ttaggcaacactcatcttgcattgatgtacttcagttgggctacagatttagaccctaaa
ggcgtcaatagccaaataaaagaagctattcttagccctggacaaggtgaagatgaatct
ttcgtagctcagtcagcagaagagcaaacgctcaatagttccacagagcaagaaggagaa
gcaagcggcgaagcaagtggtgaaggcagcgctgtcgttgccaatgtgacggctgatgct
caggcagacgatagcgacgatagtagtttatga

DBGET integrated database retrieval system