KEGG   Nasonia vitripennis (jewel wasp): 100123405
Entry
100123405         CDS       T01081                                 
Name
(RefSeq) casein kinase I isoform X1
  KO
K08958  casein kinase 1, gamma [EC:2.7.11.1]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
nvi04341  Hedgehog signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:nvi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04341 Hedgehog signaling pathway - fly
    100123405
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nvi01001]
    100123405
Enzymes [BR:nvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100123405
Protein kinases [BR:nvi01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   100123405
SSDB
Motif
Pfam: CK1gamma_C Pkinase PK_Tyr_Ser-Thr Pkinase_fungal YrbL-PhoP_reg
Other DBs
NCBI-GeneID: 100123405
NCBI-ProteinID: XP_016842305
NASONIABASE: NV13701
UniProt: A0A7M7ITI6
Position
5
AA seq 550 aa
MKKNEGRDGRADKEPQRGSDRDKEREQEAGKRASRTSGNATRPNMHTSRHSVTSTSNLLM
VGPNFRVGKKIGCGNFGELRLGKNLYNNEHVAIKMEPMKSRAPQLHLEYRFYKLLGTQEG
VPEVYYFGPCGKFNALVMELLGPSLEDLFDLCGRRFTLKTVLNIATQLLHRIEYVHSRHL
IYRDVKPENFLIGRSTMNREKIIHIIDFGLAKEYIDLETNKHIPYREHKSLTGTARYMSI
NTHQGKEQSRRDDLEALGHMFMYFLRGSLPWQGLRADTLKERYQRIGDTKRATPIEVLCE
GHPEEMATYLRYVRRLDFFDTPDYEYLRKLFQDLYERRGFANDGEFDWTGKTMPPNFAQL
RALRMAAPSNIEKTKSDKSTPVGSLQTGHEILVSPNRDRHPANYKDAAGGGVGGGGGKGV
GASWPDTVKQSGAGGTLTPADRHGSVQVVSSTNGELANDDPTAGHSNTPITAPPEVEMID
ETNLKHVAIVHGKNLVPTEHCRKLTIDEKRAAHEAYRDVLKTYSWPLQHFLLNNIINKIR
KEGTFDIPLR
NT seq 1653 nt   +upstreamnt  +downstreamnt
atgaagaagaacgagggcagagacggtagggcagacaaggagccccagcgtggcagtgac
agagacaaagagcgagagcaggaagctggaaagagagcctcgcggaccagtggcaatgcc
actaggcccaacatgcatacctctcgacacagcgtcacctccacgtcgaacctactcatg
gttggtcctaatttccgggttggaaagaaaattggctgtggtaactttggggagcttcga
cttggaaaaaacctctacaataatgaacacgtagcaattaaaatggaaccaatgaagtca
agggcgccacagcttcacttggaatataggttttacaaattattaggtacacaggaaggc
gtgccggaagtttattatttcggcccgtgcggcaagttcaacgcattggtgatggaactc
cttggtcctagcctcgaagatctcttcgacctctgtgggaggagatttaccttaaagacc
gtcctcaacattgccacgcaactcctccataggatagaatacgttcatagtcggcatctc
atataccgggacgtgaaaccggagaatttcctcatcggacgaagtacgatgaacagggaa
aagatcattcacatcatcgacttcggactagccaaagagtacatagacctggaaaccaat
aagcacataccttatcgagaacataaaagtctgacgggcaccgcgcggtacatgagcatc
aacacacatcaaggcaaagaacaaagccgaagagacgatctcgaggctctgggccacatg
ttcatgtactttctgaggggcagcctgccgtggcaaggactgagagctgacactctgaag
gagcggtatcagaggatcggcgacacgaagcgcgccacgccaatcgaagtgctgtgcgag
ggccatcccgaagagatggccacgtacctgcgctacgtacgccgactcgacttcttcgac
acgccagactacgagtacctgagaaagctcttccaggatctttacgagagaagaggcttc
gccaacgacggcgaattcgactggacgggcaaaaccatgccaccgaactttgcacagctc
agagcactaaggatggctgctccatcgaatatagagaaaacaaagtcagacaagtcgaca
ccggtgggatcgctccagacaggccacgagatcctcgtatcaccgaatcgagacagacac
cctgctaattacaaggacgcggctggtggcggggtgggaggagggggcggtaagggggta
ggtgcctcgtggcctgacacagtcaagcaatcgggcgccggtggcaccttgacacccgcc
gaccgacatggctccgtacaggttgtatcctcgacgaatggagaattggcaaacgacgac
cccacagctggtcactcgaatacaccaataactgcaccaccagaagtggagatgatagac
gaaaccaacttaaaacacgtagctatagtacatggtaaaaatttagtacctactgagcat
tgtagaaaattaactattgatgagaaaagagctgcacatgaagcttatagggatgtatta
aaaacgtattcgtggccacttcagcattttcttttgaataatattataaataaaattcga
aaagagggtacttttgacattccactcagatga

DBGET integrated database retrieval system