KEGG   Nasonia vitripennis (jewel wasp): 100123549
Entry
100123549         CDS       T01081                                 
Name
(RefSeq) angiotensin-converting enzyme
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Brite
KEGG Orthology (KO) [BR:nvi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:nvi01002]
    100123549
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nvi04147]
    100123549
   04090 CD molecules [BR:nvi04090]
    100123549
Enzymes [BR:nvi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     100123549
Peptidases and inhibitors [BR:nvi01002]
 Metallo peptidases
  Family M2
   100123549
Exosome [BR:nvi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100123549
CD molecules [BR:nvi04090]
 Proteins
  100123549
SSDB
Motif
Pfam: Peptidase_M2 DUF6374
Other DBs
NCBI-GeneID: 100123549
NCBI-ProteinID: XP_001607198
NASONIABASE: NV13720
UniProt: A0A7M7G9F8
Position
5
AA seq 777 aa
MEVVLRPVFVVVVDHRRLHFVTAALLLFLAINQVTCQLDLPPLRDDQRYSDPNNDRYNDR
TSDRYLDRNTDRYADRFNDRNQDQPFNDRNQDQRFNDGRRFPQNDDDRYDRFEGNRRPQD
NRGGIRDDPRFDNRRPVQQIDYANLLAGLDFVGTQRCSNNVAAQWNYETNVNEVSQLQAL
QAQRLYADFQYQTWQQISQIDPNTVREPLIRRRLRYLSAVGPAALPPDQLERYNRLINDM
LTIYNSATICAYKDPLRCGLRLFPEISQTVARSRDWDELQWVWLEWRRRSGSQMKDLYMQ
LVDLNNDAARMNNFTDAAEYWQFPYESFNFEREVDEVWEEIKPLYEELHAYVRRKLRDLY
GPEKISRQAPLPSHILGNIWGQSWVNILDLTLPYPGKNYLDVTQEMQAQGYTPIEMFRAG
EDFFLSLNLSVLPPEFWAGSLIVDPGDRPLICQASAWDFCNGIDYRIKMCTKVTMKDLIT
VHHEMAHIQYFLRYSRLPREFRDGANPGFHEAIGEAVALSVATPKHLQTLGLGNKYIDER
SSDINYLFSLAMEKLVLLPYSIALDKWRWDVFRGVVNREEYNCHWHRLKERYSGTKPPVL
RSEDDFDPGSKYHIPANIPYIRNFVAGVLQFQLYRALCQAAGQRNPEDPRKPLHKCDFYR
SPEAGRILGRLMERGSSVPWQDVLFEATGESRLDPSALREYFRPLEDWLRTENLRTNELV
GWTYDGDYCKRSIETAGLEVYGSGLYQGYYNSGPRVSGALGNSALLGLLLTLALSSF
NT seq 2334 nt   +upstreamnt  +downstreamnt
atggaggtggtgttgaggccggtcttcgtggtcgtcgtcgatcatcggagactgcacttc
gtgacggcagcgctattgctgtttctggccatcaatcaagtaacctgccaattggacctg
ccaccccttcgagacgatcagcgctacagcgatcccaacaatgatcgatacaacgatcgc
acctcggaccggtaccttgatcgcaacaccgatcggtatgccgatcggttcaacgatcgt
aaccaagatcaacctttcaacgatcgcaaccaagatcaacgttttaacgacggtcgccga
ttcccccagaacgacgacgatcgatacgaccgattcgagggtaacagacgaccccaagac
aacaggggaggcataagggacgatcctcgattcgacaaccggcgaccggttcagcaaatc
gattacgcgaacctgctcgccggtctggactttgtcggcacgcagaggtgcagcaacaac
gtcgccgcccagtggaactacgagaccaacgtgaacgaagtctcccagctacaagcgctg
caggcacaaaggctgtacgccgatttccagtatcagacatggcagcagatcagtcagatc
gacccgaataccgtgagagagcctttgatcaggagacgattgagatacctgtcggctgtt
gggccggcggcgcttccaccggatcagctcgagaggtacaatcggctgatcaacgatatg
ctgaccatctacaacagcgcgaccatctgcgcgtacaaggacccgctgcgttgtggtctc
cgcctattccctgagatctcgcagacagtggctcgcagtcgcgactgggatgagctgcaa
tgggtctggctcgagtggcgacgacgaagcggttcccaaatgaaggacctctacatgcag
ttggtcgacctcaacaacgacgctgctcgcatgaacaatttcaccgacgctgcggagtac
tggcagttcccctacgagtccttcaatttcgagcgcgaggtcgacgaggtttgggaggaa
atcaagcctctctacgaggaactccacgcttacgtcagaaggaagctgagggatctttat
ggaccggaaaaaattagccgacaggctccgctgccctctcatattctcggaaacatttgg
ggacagtcctgggtgaacattttggacctcacgctcccctatccgggcaaaaattacttg
gatgtcacgcaggagatgcaagctcagggctacacgccgatcgaaatgttccgcgcggga
gaggacttcttcctgtcgctgaatctgagcgtactcccgccggaattctgggctggaagt
ctgatcgtcgaccccggcgacaggcctcttatctgccaggcttcggcttgggacttttgc
aacggcatcgactacagaataaagatgtgcacgaaggtgacgatgaaggacctgataacg
gtgcaccacgagatggcccacatccagtacttcctgcgctacagccgtctacctcgggag
ttccgcgacggcgcgaatcccggttttcacgaagccatcggcgaggccgtcgccctcagt
gtggctacgcccaagcatctgcagactctgggcttgggcaacaagtacatagacgaacga
tcgtccgacataaattacctgttctcgctggcgatggagaaactagtgctgctgccctac
agcatcgccctggacaagtggcgctgggacgtcttccgcggagtggtcaacagggaggag
tacaactgccactggcatcgactgaaggaacgttactccggcactaagccaccggtgctc
agatccgaggacgacttcgaccccggctccaagtatcacatacccgctaacataccctat
atcaggaatttcgtcgccggggtgctgcagttccagctgtacagggcactgtgtcaagcg
gcgggacagaggaatcccgaggatccgcgcaagcccctgcacaagtgcgatttttacagg
agccccgaagccggcaggatactgggaagactgatggaacgagggtcttcggtgccctgg
caggacgtgcttttcgaggcgacgggcgagtcgagattggacccgtccgcccttagggag
tacttccggccgctcgaagattggctccgcaccgaaaacctcaggaccaacgaactcgtc
ggctggacctatgacggcgactactgcaagcgcagcatcgagacggccggtctggaggtc
tacggcagcggcctgtaccagggctactacaacagcggcccgagggtatcaggcgccttg
ggcaacagcgcgctcctaggcctcctgctgaccctggccttatcctcgttctag

DBGET integrated database retrieval system